KEGG   Clostridium botulinum BKT015925: CbC4_2331Help
Entry
CbC4_2331         CDS       T01475                                 

Definition
(GenBank) site-specific recombinase, resolvase family, putative
Organism
cbn  Clostridium botulinum BKT015925
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Resolvase Recombinase Zn_ribbon_recom DUF4368
Motif
Other DBs
NCBI-ProteinID: AEB76996
Position
complement(2528549..2530135)
Genome map
AA seq 528 aa AA seqDB search
MEKIWNVAIYTRVSTDKKEQSESIPAQVQSLKKWLLEKSGNDKQEIYKLQQIYKDQGFSG
SNFERESFIKMKKDIENGKINMVLTRDLSRFARNYITAGYYLEDYFKNKGVRFVSVLDNV
DTIDEVDDIVPFKNILNEMYIKDCSRRTRDGLKQRMIRGSSIASKPPYGYRFEENYDESI
KSIKLVPREDETTKVVKKIFELYIQGFGMGRIATYLNDRGIAPPSALIKNFSRSKFKLWN
NNTIRSILTNPKYAGVMVQGRWKKVSYKIKKIRPTSKDEWIIGGEFKGIVSKQIFEIVQE
LMKKRSKVFRHKGGNVHLFSGILKCNECGGSMSYRGDFKGYKCTNSQMGGGRCTAHSIKE
EYLVKEIRENIKKYINKIDSTKKFYDLAKVKLEDNNNYKKKLKNIDKELKILDDKFQKIY
SDNLNRTINERNFKNLISGIENQQQRLINRKKYIENLYLNNDYKEKIYYEYKTKVDKILN
FEEVDRFIIENLIDKIVVSENKITKEKNIDIYYKFKEPISIMNPPQHV
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaatatggaatgtagctatatatacacgtgtatccacggataaaaaggagcaa
tcagaatctatacctgctcaagttcaaagtttaaaaaaatggcttctggaaaaaagtggt
aatgataaacaagaaatttataaacttcaacaaatatacaaagatcaaggattttcagga
tctaactttgaaagagaaagctttataaagatgaagaaagatatagaaaatggaaaaata
aatatggtgttaactcgtgatttatctagatttgcaagaaattatataactgcgggatat
tacttagaagattattttaaaaataagggtgttagatttgtatcagtattggataatgta
gatacaattgatgaagttgatgatattgtaccctttaaaaatattttaaatgaaatgtat
attaaagattgttccagaagaacaagagatggacttaaacaaagaatgattagagggtca
tcaattgcaagtaaaccaccatatggatataggtttgaggaaaattatgatgaaagtatt
aaaagtataaagttagttccaagagaagatgaaacaactaaagttgttaaaaagattttt
gaactatatattcagggctttggtatggggagaatagcaacttacttaaatgatagagga
atagcaccaccatcggcattaattaaaaattttagtaggtcaaaatttaaactatggaat
aataacactatacgatctatacttacaaatcctaaatatgctggtgttatggttcaggga
agatggaaaaaggttagttacaaaattaagaagataagacccacatcaaaggatgaatgg
attataggaggagagtttaaaggaatagtatcaaaacaaatttttgaaatagttcaagaa
cttatgaagaaaagaagtaaagtttttagacataaaggaggaaatgtacatttattttca
ggtattcttaagtgtaatgagtgtggtggaagtatgagttatagaggtgattttaaagga
tataaatgcacaaatagtcaaatgggaggggggagatgtactgcccattctataaaggaa
gaatatttagtaaaagagattagagaaaatataaaaaaatatataaataaaatagatagt
acaaaaaaattttatgatttagcaaaagtgaaactagaagacaataataactataaaaag
aaactaaaaaatatagataaagaattaaaaatattagatgataaatttcaaaaaatttat
tctgataatttaaatagaacaattaatgaaagaaattttaaaaatttaattagtggtata
gagaaccagcagcaaaggttaattaatagaaaaaaatatatagaaaatctatacttaaat
aatgattacaaagaaaaaatatattatgagtataaaactaaggtagataaaatattaaat
tttgaagaagttgatagattcataattgagaatttaatagataaaattgttgtttcagaa
aataaaattactaaagaaaaaaatatagatatttattataaatttaaagaaccaatatca
attatgaatccaccgcaacatgtatag

DBGET integrated database retrieval system