KEGG   Clostridium botulinum BKT015925: CbC4_2336Help
Entry
CbC4_2336         CDS       T01475                                 

Gene name
serA
Definition
(GenBank) D-isomer specific 2-hydroxyacid dehydrogenase
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Organism
cbn  Clostridium botulinum BKT015925
Pathway
cbn00260  Glycine, serine and threonine metabolism
cbn00680  Methane metabolism
cbn01100  Metabolic pathways
cbn01120  Microbial metabolism in diverse environments
cbn01130  Biosynthesis of antibiotics
cbn01200  Carbon metabolism
cbn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cbn00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    CbC4_2336 (serA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CbC4_2336 (serA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cbn04147]
    CbC4_2336 (serA)
Enzymes [BR:cbn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     CbC4_2336 (serA)
    1.1.1.399  2-oxoglutarate reductase
     CbC4_2336 (serA)
Exosome [BR:cbn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CbC4_2336 (serA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 IlvN AdoHcyase_NAD ADH_zinc_N Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AEB77001
Position
complement(2532182..2533135)
Genome map
AA seq 317 aa AA seqDB search
MRISILESLGLPKEEVYSIAKPLINKGHEIIFYEDKMEDTEILKERAKGADVLVLANMPL
NGEVIRSDENLKMVSVAFTGVDHVDSKACIDKNIRVCNAAGYSTSSVAELTYGLIFSVFR
NIVPLDKATRKAGTRAGFSQSELLGKTIGIVGTGAIGLRVGEIAKAFGCKVLAYSRTQKQ
QAIDLGFEYVSLDELLASSDVISLHVPLSNETRGLISKEKINLMKSSSILINTARGPVID
NIALAEALKQGKIAGAGIDVFEIEPPIEKSHPLFNISNVVVTPHIAFATKEAMYRRAKIT
FDNIEKWIEGNPQNIML
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatatcaatattagaatcattaggattaccaaaagaagaagtatattctatagct
aaaccacttatcaataaaggacatgaaataatattttatgaagataagatggaggataca
gaaatccttaaagaaagagctaagggggcagatgttttagtattagctaatatgccttta
aatggagaagtaataagatcagatgaaaatctaaaaatggtttctgttgcttttacagga
gtagatcatgtagattcaaaggcatgtattgataaaaatattagggtgtgtaatgcagca
gggtatagtacatcgtctgtagcagaacttacgtatggacttattttttctgtatttaga
aatatagttcctttagacaaggctacaagaaaagctggtacaagagcgggattttcacaa
agtgaacttttaggaaaaactattggtatagttggaactggagctataggcctaagggtt
ggagaaatagctaaagcttttggatgtaaggtattagcttatagtagaacacaaaaacaa
caagctatagatctaggatttgaatatgtatcattagatgagttattagctagtagcgat
gtaatctcattacatgtaccattaagtaatgaaacaagaggcctgataagcaaagaaaag
ataaatttaatgaagtcatcatctatattaattaatacagctagaggaccagttatagat
aatattgctttagctgaggctttaaagcaagggaaaattgctggtgctggtattgatgtt
ttcgagattgaaccaccaatagaaaagagtcatcctttatttaatatttcaaatgttgtt
gtaactccgcatattgcttttgccacaaaggaagctatgtatagaagggcaaaaataact
tttgataatatagaaaaatggatagaaggaaatcctcaaaatataatgttatag

DBGET integrated database retrieval system