KEGG   Clostridium botulinum BKT015925: CbC4_2338Help
Entry
CbC4_2338         CDS       T01475                                 

Definition
(GenBank) Mannose-1-phosphate guanylyltransferase (GDP)
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
cbn  Clostridium botulinum BKT015925
Pathway
cbn00051  Fructose and mannose metabolism
cbn00520  Amino sugar and nucleotide sugar metabolism
cbn01100  Metabolic pathways
cbn01110  Biosynthesis of secondary metabolites
Module
cbn_M00362  Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:cbn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    CbC4_2338
   00520 Amino sugar and nucleotide sugar metabolism
    CbC4_2338
Enzymes [BR:cbn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     CbC4_2338
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD Ykof Spore_YhcN_YlaJ Tfb5
Motif
Other DBs
NCBI-ProteinID: AEB77003
Position
complement(2533409..2533675)
Genome map
AA seq 88 aa AA seqDB search
MIYALILAGGKGTRLYPLSREKSPKQFLKVINEKSFLRNTVDRISSIVDKQNTYVVTNKD
YIDKIKDELSDINQDNIFIEPANKETSL
NT seq 267 nt NT seq  +upstreamnt  +downstreamnt
gtgatatatgcactaatattggccggtggaaaagggacaagactttatcccttatctcgt
gaaaaaagtccaaaacaatttttaaaggttattaatgaaaagagttttttaagaaatact
gtggatagaataagttcaattgtagataaacaaaatacgtatgttgttacaaataaggat
tatatagataagataaaagatgaattatcagatataaatcaagataatatttttattgaa
cctgctaataaggagacctctttataa

DBGET integrated database retrieval system