KEGG   Clostridium botulinum BKT015925: CbC4_2340Help
Entry
CbC4_2340         CDS       T01475                                 

Definition
(GenBank) 3-hydroxybutyryl-CoA dehydrogenase
  KO
K00074  3-hydroxybutyryl-CoA dehydrogenase [EC:1.1.1.157]
Organism
cbn  Clostridium botulinum BKT015925
Pathway
cbn00360  Phenylalanine metabolism
cbn00362  Benzoate degradation
cbn00650  Butanoate metabolism
cbn01100  Metabolic pathways
cbn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cbn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CbC4_2340
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    CbC4_2340
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CbC4_2340
Enzymes [BR:cbn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.157  3-hydroxybutyryl-CoA dehydrogenase
     CbC4_2340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N 3HCDH UDPG_MGDP_dh_N NAD_Gly3P_dh_N F420_oxidored NAD_binding_2 Asp_Glu_race adh_short_C2 ApbA Pyr_redox Methyltransf_16 DUF1803
Motif
Other DBs
NCBI-ProteinID: AEB77005
Position
complement(2535043..2535888)
Genome map
AA seq 281 aa AA seqDB search
MKICVLGAGTMGSGIAQAFAVKGHKVVLRDIKDEFVEKGINGINKSLSKLVKKGKMEEAK
KDEILSNINGTVDLNMAADCDLVVEAAIENMEIKKQIFGELDKICKPQTILASNTSSLSI
TEVASATNRPEKVIGMHFFNPAPVMKLIEVIRGMATSKETFDTVKEISTEIGKEPVEVAE
APGFVVNRILIPMINEAVGILAEGIASAEDIDTAMKLGANHPMGPLALGDLIGLDVCLAI
MDVLYKETGDSKYRAHTLLRKYVRAGYLGRKSGRGFHDYSK
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatatgtgttctaggtgctggaacaatgggatcaggaattgctcaagcatttgct
gtaaaagggcataaagttgtcttaagagatatcaaagatgaatttgtggaaaaaggaatt
aatggtataaataagagtctttcaaagttagttaaaaaaggaaagatggaagaagcaaaa
aaagatgaaatactttctaatataaatggaacagttgaccttaatatggcagctgattgt
gacctagttgtagaagcagcaatagaaaatatggaaatcaaaaagcagatatttggagag
ttagataagatatgtaaaccacaaacaattttagcttcaaatacatcttcactttcaata
acagaagttgcatcagcaacaaatagacctgaaaaagttataggaatgcatttctttaat
ccggctccagtaatgaagcttatagaagttataagaggaatggcaacatcaaaggaaact
tttgatactgttaaagaaatatcaacggaaattggtaaggaaccagtagaagttgcagaa
gctcctggatttgttgtaaatagaattttaattccaatgattaatgaggctgttggaatc
cttgcagaaggaattgcatcagcagaagatatagatacagctatgaaactgggagctaat
cacccaatgggacctttagcattaggagatcttataggacttgatgtatgtcttgctata
atggatgtattatataaagaaacaggggattcaaaatatagagcccacacattacttaga
aaatatgttagagctggatatcttggaagaaaatcaggaagaggatttcacgattattca
aaataa

DBGET integrated database retrieval system