KEGG   Clostridium botulinum BKT015925: CbC4_2342Help
Entry
CbC4_2342         CDS       T01475                                 

Definition
(GenBank) glycerol uptake facilitator protein
  KO
K02440  glycerol uptake facilitator protein
Organism
cbn  Clostridium botulinum BKT015925
Brite
KEGG Orthology (KO) [BR:cbn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cbn02000]
    CbC4_2342
Transporters [BR:cbn02000]
 Other Transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaglyceroporins or glycerol-uptake facilitators
    CbC4_2342
Ion channels [BR:cbn04040]
 Non-ion channels
  Aquaglyceroporins or glycerol-uptake facilitators
   CbC4_2342
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MIP
Motif
Other DBs
NCBI-ProteinID: AEB77007
Position
complement(2537826..2538536)
Genome map
AA seq 236 aa AA seqDB search
MSRFMAEFLGTMLLILLGDGVVACVSLNKSKGQNGGWIVVTTSWAIAVAVPALIFGAISG
AHFNPAVTIAFALINFGGITWGMVPGYIIAQMLGAMLGAALVWIAYLPHWSETKDPAVKL
GVFCTAPAIRNSAANLITEIIGTFVLVFAILGLSKAAQAPGIGVYSVGLVILVIGLALGG
PTGYAINPARDLGPRIAHAILPISGKGDSDWGYAWIPVVGPIIGGIIGALLFAALF
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgtctagatttatggcagaattcttaggcacaatgttacttattctattaggtgatggt
gtagtagcttgcgtatcactaaataagagtaaaggacaaaatggaggatggatagttgta
acaacatcttgggcaatagcagtagctgttccagcacttatctttggtgcaataagtgga
gctcactttaatccagctgttactatagcctttgcattaattaattttggtggtataact
tggggaatggttccaggttatataattgcacagatgttaggagcaatgcttggagccgct
ctagtatggattgcttatttaccacattggagtgaaactaaagatccagcagtaaagcta
ggagtattttgtactgcaccagcaattagaaatagtgctgccaatcttataacagaaatt
ataggaacatttgtacttgtatttgcaattttaggactttcaaaggcagctcaagcacca
ggaattggagtgtattcagttggacttgtaatattagtaattggtcttgcgttaggtgga
ccaacaggatatgcaattaatccagccagagatttaggacctcgtatagcacatgcaata
ctacctatatcaggtaaaggagattcggattggggatatgcttggataccggtagttgga
ccaataataggaggaataataggtgctctattatttgcagccctattttaa

DBGET integrated database retrieval system