KEGG   Clostridium botulinum BKT015925: CbC4_2348Help
Entry
CbC4_2348         CDS       T01475                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
cbn  Clostridium botulinum BKT015925
Pathway
cbn00564  Glycerophospholipid metabolism
cbn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cbn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CbC4_2348
Enzymes [BR:cbn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     CbC4_2348
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD Pyr_redox_3 Pyr_redox_2 Pyr_redox Lycopene_cycl NAD_binding_8 FAD_binding_3 HI0933_like FAD_binding_2 Thi4 TrkA_N 3HCDH_N SO_alpha_A3 ApbA Antifungal_pept
Motif
Other DBs
NCBI-ProteinID: AEB77013
Position
complement(2545129..2546562)
Genome map
AA seq 477 aa AA seqDB search
MFDITIVGAGVIGCSIARELSKYDLKVCVLEKGPDVATGTSKANSGIVHGGHDATPGTLK
AKLNVRGNEMFDKLVKELDFPFKRNGSLVLCFDESEKDGLQALLEKGKKNGVKNLEIIDK
ERILELEPNVNDDVVAALHVPTGGIVCPYEMTIAMAENAYTNGVEFKFETEVKNIVKKEN
GFTVETNKGNIETNLVINAAGLFSDELNNMVSANKIEIVARKGEYCLFDKAAGAMATKTL
FQLPTKMGKGVLVSPTVDGNLLIGPNAVDVNDKTDVDTTQEGIDDILERAKKTFRQIPMR
QVITSFSGLRSHDTVNDFIIGEVEDASGFINVAGIESPGLSSAPAIAEMVEGIVVEKLSP
AKNEKFNPIREGIPKFREMNNEERKALVAKDPSYGKIVCRCETVTEGEIINAIRRPLGAK
DLDGIKRRTRAGMGKCQSGFCSTKLVAILAKELNIPVTEVTKFGGKSNLLIGEDKEI
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgtttgacattacaattgttggtgcaggggttattggctgcagtatagcaagagaatta
tctaaatatgatttaaaagtatgtgtactagaaaagggaccagatgtagcaacaggtact
tcaaaagctaatagtggtatagttcatggtggacatgacgcaacaccaggtactttaaaa
gctaaattaaatgtaagaggaaatgaaatgttcgataaattagtaaaagaacttgatttc
ccatttaaaagaaatggttcattagtactatgttttgatgaatcagaaaaagatggttta
caagcattacttgaaaagggaaagaagaatggtgttaaaaaccttgaaattatagataaa
gaaagaatattagaattagaacctaatgtaaacgatgacgtggtagcagctttacatgta
ccaacaggtggtattgtatgtccttacgaaatgactatagcaatggctgaaaacgcatac
actaatggagtagaatttaaatttgaaacagaagttaagaatatagttaaaaaagaaaat
ggatttacagttgaaacaaataaaggaaatattgaaactaacctagtaataaatgcagca
ggattattctcagatgaattaaataatatggttagtgcaaataaaatagagatagtagca
agaaaaggtgaatattgcttatttgacaaagctgcaggagcaatggcaacaaaaacttta
ttccaattaccaactaaaatgggtaaaggtgttcttgtaagtccaacagtagatggtaac
ttactaataggaccaaatgcagtagatgtaaacgataaaactgatgtagatactactcaa
gaaggaatagatgatatattagaaagagctaaaaaaacatttagacaaattccaatgaga
caagttataacttcattctcaggacttagatctcatgatacagtaaatgactttataata
ggagaagtagaagatgcttctggctttataaatgtagctggtatagaatcaccaggactt
tcaagtgctccagcaatagctgaaatggttgaagggatagttgtagaaaaattatcgcca
gctaaaaatgagaaattcaacccaataagagaaggtatccctaaatttagagaaatgaat
aatgaagaaagaaaggctcttgtagctaaagatccaagctatggaaagatagtatgtaga
tgtgaaacagttactgaaggtgaaataatcaatgctataagaagaccacttggagctaaa
gatttagatggaattaagagaagaacaagagctggtatgggtaaatgtcaatcaggattc
tgttctacaaaattagttgctattttagcaaaagagttaaatataccagtaactgaggta
actaaatttggcggaaaatctaacttattaattggagaagacaaagaaatttag

DBGET integrated database retrieval system