KEGG   Clostridium botulinum BKT015925: CbC4_2353Help
Entry
CbC4_2353         CDS       T01475                                 

Definition
(GenBank) major cold shock protein
  KO
K03704  cold shock protein (beta-ribbon, CspA family)
Organism
cbn  Clostridium botulinum BKT015925
Brite
KEGG Orthology (KO) [BR:cbn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cbn03000]
    CbC4_2353
Transcription factors [BR:cbn03000]
 Prokaryotic Type
  Other transcription factors
   Others
    CbC4_2353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CSD OB_RNB
Motif
Other DBs
NCBI-ProteinID: AEB77018
Position
complement(2550424..2550624)
Genome map
AA seq 66 aa AA seqDB search
MKTGIVKWFNAEKGFGFISVEGEDDVFVHFSAIQGDGFKTLEEGQKVEFEVTEGARGPQA
ANVVKL
NT seq 201 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaggaatagttaaatggtttaacgcagaaaaaggatttggatttatatctgta
gaaggagaagatgacgtattcgtacatttctcagctatccaaggagatggattcaaaact
ttagaagaaggacaaaaagttgaattcgaagtaactgaaggtgctagaggacctcaagct
gctaacgtagttaaactataa

DBGET integrated database retrieval system