KEGG   Clostridium botulinum BKT015925: CbC4_2355Help
Entry
CbC4_2355         CDS       T01475                                 

Definition
(GenBank) conserved hypothetical protein
Organism
cbn  Clostridium botulinum BKT015925
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEB77020
Position
complement(2551486..2551635)
Genome map
AA seq 49 aa AA seqDB search
MKVLHWIGAIVVFFWILGIVFKIGGKLINILLIIAAIIFIYDVITDKRR
NT seq 150 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtattacattggataggcgccattgtagtattcttttggatattgggaattgta
ttcaaaataggaggaaaattaataaatatattattgataatagcagcaataatatttatt
tatgatgtaattactgacaagagaagatga

DBGET integrated database retrieval system