KEGG   Clostridium botulinum BKT015925: CbC4_2358Help
Entry
CbC4_2358         CDS       T01475                                 

Definition
(GenBank) chorismate mutase
Organism
cbn  Clostridium botulinum BKT015925
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CM_2 DUF4889
Motif
Other DBs
NCBI-ProteinID: AEB77023
Position
complement(2553422..2553712)
Genome map
AA seq 96 aa AA seqDB search
MEESISMDDLKELRKEIDSIDNKLICLFQKRMEAVLKVAEYKKKNNVPILSTSREQEVID
KNIKLVCNDDFKKPVEDFLKSIMSISKELQAKKISE
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
atggaggagagtatttcaatggatgatttgaaagaattaagaaaagaaatagattcaata
gataataaattaatttgtttatttcaaaagaggatggaagcagttttaaaggttgctgaa
tataagaaaaaaaataatgtacccatattaagtacaagtagggaacaggaagttatagat
aaaaatattaaactagtatgtaatgatgattttaaaaaaccagttgaagattttttaaag
agtataatgagtataagcaaagagcttcaagctaaaaaaatatcagaatag

DBGET integrated database retrieval system