KEGG   Clostridium botulinum BKT015925: CbC4_2359Help
Entry
CbC4_2359         CDS       T01475                                 

Gene name
aroC
Definition
(GenBank) Chorismate synthase
  KO
K01736  chorismate synthase [EC:4.2.3.5]
Organism
cbn  Clostridium botulinum BKT015925
Pathway
cbn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cbn01100  Metabolic pathways
cbn01110  Biosynthesis of secondary metabolites
cbn01130  Biosynthesis of antibiotics
cbn01230  Biosynthesis of amino acids
Module
cbn_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:cbn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CbC4_2359 (aroC)
Enzymes [BR:cbn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.5  chorismate synthase
     CbC4_2359 (aroC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_synt
Motif
Other DBs
NCBI-ProteinID: AEB77024
Position
complement(2553714..2554781)
Genome map
AA seq 355 aa AA seqDB search
MSGIWGSKIKYSIFGESHGKAIGITIDGLSAGIELDLNEVSREMRRRAPGKSKLSTSRLE
MDEFEIISGYFDNKTTGTPLCAIIQNSDKHSKDYEKTKDLMRPGHADFTGYIKYSGFNDY
RGGGHFSGRITAPIVFAGAIAKQILKRNNIIIGSHIKSIGSIEEEYFRVSIKEEFLKELS
RKTFATIDDKKGKEMQEAILEVRNNMDSIGGIIECAVLNMPPGLGNPFFGSVESVLSSLL
FSIPAVKGVEFGAGFSISKMKGSQANDEFYMENEKVKTYTNNNGGILGGITNGMPLIFRT
AFKPTPSIAKEQKTINISNKENTTIEIQGRHDPCIVQRAVPVVEAITAMGILELI
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgagtggaatatggggaagtaaaataaaatattctatatttggagaatctcatggaaag
gcaattggaataacaatagatgggttgtcagctggaattgaactagatttaaatgaagta
agtagagaaatgagaagacgtgctccaggtaaaagtaaactttcaacatctagattagaa
atggatgaatttgaaattataagtggatattttgataataaaacaacaggtactccttta
tgtgctattatacaaaactcagataagcattcaaaggactatgaaaaaactaaagattta
atgagacctggccatgctgattttactggatatataaaatatagtggttttaatgattat
agaggtggaggacatttttcagggagaattactgcacctatagtatttgcaggagctatc
gcaaaacaaattttaaaaagaaataatattataattggaagccatataaaaagtatagga
agtattgaagaagaatattttagagtttccataaaagaagagtttttaaaagaattatca
agaaaaacttttgcaactattgatgataaaaaaggaaaagagatgcaagaggcgatttta
gaagttcgaaataatatggattccattggtggaattatagaatgcgcggttttaaatatg
ccacctggactaggaaaccccttttttggatcagttgaaagtgttctaagtagtttatta
ttttcaataccagctgtaaagggtgtggagtttggtgccggatttagtatttctaaaatg
aagggtagccaggcgaatgatgaattttatatggaaaatgaaaaagtaaaaacttatacc
aataataatggtggaattttaggtggaattacaaatggaatgcctttaatatttagaact
gcttttaagccaacaccatcaattgcaaaagaacaaaaaacaataaatatttcaaataaa
gaaaatacaactatagaaattcaaggaagacacgatccttgtatagttcaaagggctgtt
cctgtagttgaagctattacagctatgggaatattagaattaatttaa

DBGET integrated database retrieval system