KEGG   Clostridium botulinum BKT015925: CbC4_2360Help
Entry
CbC4_2360         CDS       T01475                                 

Gene name
aroA
Definition
(GenBank) 3-phosphoshikimate 1-carboxyvinyltransferase
  KO
K00800  3-phosphoshikimate 1-carboxyvinyltransferase [EC:2.5.1.19]
Organism
cbn  Clostridium botulinum BKT015925
Pathway
cbn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cbn01100  Metabolic pathways
cbn01110  Biosynthesis of secondary metabolites
cbn01130  Biosynthesis of antibiotics
cbn01230  Biosynthesis of amino acids
Module
cbn_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:cbn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CbC4_2360 (aroA)
Enzymes [BR:cbn01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.19  3-phosphoshikimate 1-carboxyvinyltransferase
     CbC4_2360 (aroA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase
Motif
Other DBs
NCBI-ProteinID: AEB77025
Position
complement(2554759..2556066)
Genome map
AA seq 435 aa AA seqDB search
MKNVTIIPSELSGDINIPPSKSLAHRAIISAGLSEGVSNIENIIFSEDIKATIRGMKSFG
IEIQDITKKNQYNFNRKTLKIIGRDRLVLKNSEIDCSESGSTLRFLIPISLRTGNKVKFT
GKGKLVSRPLDVYYNMFENQGIKYKTSNGKLPLFIDGVLKSGEFYVKGNISSQFITGLMY
TLPFLNGDSKMIVTTELESKGYVDLTIDTLKKFGIKIENKNYKEFFIKGNQKSITNNYRV
QGDFSQGAFWIVAGILGSNVKILDLDINSLQGDRVIVDIVKNMGANIKINENYIETKKSK
TKGITIDASECPDLVPILSVLASLSTGTTKIINAERLRIKECDRLKAMATELKKIGADIE
ELEDGLLIKGREYLKGGTVDSWNDHRIAMSMAIASIKCKEPITIKNSDAVNKSYPDFWED
LKKVGGNINEWNMGK
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatgtaacaattattccctcagaattaagtggagacataaatattccaccatct
aagagtttagctcatagagctataataagtgcaggactctcagaaggggtaagcaatatt
gaaaatataatattttcagaggatataaaagccactattagaggaatgaaaagttttggt
atagaaattcaagatataactaaaaaaaatcaatataattttaatagaaaaactttaaaa
attataggaagagatagattggttttaaaaaatagtgagatagattgttccgagtcgggt
tctacgttaagattcttaattcctatatcattacgaacaggtaataaagttaaatttaca
ggcaaaggcaaacttgtatcaagaccacttgatgtatactataatatgtttgaaaatcaa
ggaataaaatacaaaactagtaatggaaagctacctttatttatagatggagttctaaaa
tcaggggagttttatgttaaagggaatataagttctcagtttataacaggacttatgtat
acacttccatttttaaatggagattctaaaatgatagttacgacagaacttgaatctaag
ggatatgtagatttaactatagatactttaaagaagtttggcataaagatagaaaataaa
aattataaagaattttttataaagggtaatcagaaaagtattacaaataactatagagtt
caaggagacttttctcaaggggctttttggatagtagcaggtatattaggttctaatgta
aaaatcttagatttagatataaattcactacaaggtgatagggtaattgtagatatagta
aaaaacatgggagcaaatataaagataaatgagaattatatagaaactaaaaaatctaag
acaaagggaattacaatagatgcatctgagtgtcctgatcttgtacctattctctctgtt
ttagcatcgttaagtactggaactactaaaataataaatgcagaaagacttaggataaaa
gagtgtgatagattaaaagctatggcaacagaacttaaaaaaattggagcagatatagaa
gaacttgaagatggactacttataaaaggaagggaatatttaaaaggtggaactgttgat
agttggaatgatcatagaattgcaatgtctatggctattgcatcaattaaatgtaaagaa
ccaattactataaagaatagtgacgctgttaataaatcttatccagatttctgggaagat
ttaaagaaagttggaggaaacataaatgagtggaatatggggaagtaa

DBGET integrated database retrieval system