KEGG   Clostridium botulinum BKT015925: CbC4_2362Help
Entry
CbC4_2362         CDS       T01475                                 

Definition
(GenBank) Prephenate dehydrogenase
  KO
K04517  prephenate dehydrogenase [EC:1.3.1.12]
Organism
cbn  Clostridium botulinum BKT015925
Pathway
cbn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cbn00401  Novobiocin biosynthesis
cbn01100  Metabolic pathways
cbn01110  Biosynthesis of secondary metabolites
cbn01130  Biosynthesis of antibiotics
cbn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cbn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CbC4_2362
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    CbC4_2362
Enzymes [BR:cbn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.12  prephenate dehydrogenase
     CbC4_2362
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDH NAD_binding_2 F420_oxidored ApbA Imm30
Motif
Other DBs
NCBI-ProteinID: AEB77027
Position
complement(2557142..2557993)
Genome map
AA seq 283 aa AA seqDB search
MEDFDFNITIVGLGLMGGCYASSLKKLNPRNIYAVDVDKEALKLGKKRGIIDKGFTSPEI
PLKESDLVIICLYPNRVKEFIKENMKHFKSGTIITDVTGIKTNFIEEINALLRDDIDFVF
GHPMAGREFSGVKYSSKEVFENANYIITPNKRNKLESINIIEDIVKKIGFSSVKKISPEL
HDRVIGFTSQLPHVIAVSLVNSDNLGLDIGKFTGDSYRDLTRIAKINTRLWTELFIGNKE
NLVSEIEGFQENIQELKLAIVNEDIKELNNILNKACEKREGMS
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggaggattttgattttaatataactattgtagggttagggctcatgggcggatgttat
gcaagttcattgaaaaaacttaatccaagaaatatatatgcagtagatgtagataaggaa
gctttaaaactaggaaaaaaaaggggtattattgataagggatttacaagtccagagatt
ccacttaaagagtctgatttagtaattatttgtttgtatccaaatagagttaaagaattt
ataaaagagaacatgaagcattttaaaagtggaactattataactgatgttacaggtata
aaaacaaattttatagaagaaataaatgcattattaagagatgatatagattttgtattt
ggacatccaatggctggtagagaatttagtggtgttaagtattcatcaaaagaagttttt
gaaaatgcaaattatataataactccaaataaaagaaacaaattagaaagtataaatatt
atagaagacatagttaaaaaaataggtttttccagtgtaaagaaaataagtccagaactt
catgatagggttataggatttacaagccaacttcctcatgttatagctgtgtcattagta
aatagtgataatcttggtttagatataggaaaatttacaggggatagttacagagattta
acaagaatagcgaaaataaatacaaggttatggacggaactttttataggtaataaagaa
aatctagttagtgaaatagaagggtttcaagaaaatatacaggagttaaagttagcaata
gtaaatgaagatattaaagaattaaataatatattgaataaagcatgtgaaaaaagagag
gggatgtcctaa

DBGET integrated database retrieval system