KEGG   Clostridium botulinum BKT015925: CbC4_2367Help
Entry
CbC4_2367         CDS       T01475                                 

Definition
(GenBank) Glycine betaine/carnitine/choline transport ATP-binding protein
  KO
K05847  osmoprotectant transport system ATP-binding protein
Organism
cbn  Clostridium botulinum BKT015925
Pathway
cbn02010  ABC transporters
Module
cbn_M00209  Osmoprotectant transport system
Brite
KEGG Orthology (KO) [BR:cbn00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CbC4_2367
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cbn02000]
    CbC4_2367
Transporters [BR:cbn02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Osmoprotectant transporter [MD:M00209]
    CbC4_2367
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran CBS AAA_21 AAA_15 Rad17 SMC_N AAA_16 AAA AAA_5 AAA_30 AAA_22 AAA_14 ATPase_2 AAA_29 AAA_28 AAA_33 T2SSE RsgA_GTPase G-alpha Mg_chelatase AAA_24 Zeta_toxin AAA_18 AAA_23 SRP54 AAA_25 RNA_helicase PduV-EutP AAA_19 tRNA_lig_kinase NACHT
Motif
Other DBs
NCBI-ProteinID: AEB77032
Position
complement(2561586..2562722)
Genome map
AA seq 378 aa AA seqDB search
MIKLRNIKKTFQDTKVLKNVNLSIEKGELVVLIGPSGCGKTTTLKMLNKLIKPTSGQIFI
NGEDISKKDSIKLRRNIGYVIQQTGLFPHMTVGDNIGLIPYLEGYEDEKIRKRTIELLQM
VGMKPEKYIDRYPNELSGGQQQRIGVARAFATNPEIILMDEPFSALDPITRNQLQDELFN
IQENMKKTIVFVTHDMDEALKLADKICIMKGGVVVQYDTPENILKNPSHGFVEEFIGKNR
IWNQPEYIKAEDIIIEDPVKAVATRTVLQAAEIMHERHVDSILVVDKTNTLIGIVTLKDI
RRNRENYSKVMLKEIMETDVVCIHKDKTIVDILEVMNVKNVGYIPVVDDGKKLLGLITRS
SLINVLSGQFLDIDGVGM
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgattaaactaaggaatataaagaaaacatttcaagacactaaggttctaaagaatgta
aatttaagtatagaaaaaggagagttggttgtgcttataggacctagtggatgtggtaag
acaactacattaaaaatgttaaataagctcattaaaccaacatcaggacaaatttttata
aatggtgaagatatatctaagaaagactcaataaagttacgaaggaatattggatatgta
atacaacaaacaggattatttcctcatatgactgttggagataatataggtttaatacca
tatttggaagggtacgaggatgagaaaataagaaaaaggactattgaattgttacagatg
gtggggatgaaaccagaaaagtatatagatagatatccaaatgagcttagtggaggacaa
caacaaaggataggtgttgcaagagcatttgcaacaaatccagagataatattgatggat
gagcctttttcggcattagatcctattacgagaaaccaacttcaagatgagctttttaat
atacaagaaaatatgaagaaaacaatagtttttgttactcatgatatggatgaagcatta
aaattagctgataagatttgcattatgaagggcggggtagtagtacaatatgatactcca
gagaatatattgaaaaatccatcgcatggttttgttgaagaatttataggtaagaataga
atatggaatcagccggaatatataaaagcagaggatataattatagaagacccagtaaag
gcagttgctacaaggacagtacttcaagcagctgaaataatgcatgagaggcatgttgat
agcattttagttgttgataaaacaaatacattaataggaatagtaaccttaaaagatata
aggagaaatagagaaaattacagcaaagtaatgcttaaagagattatggaaacagatgta
gtttgtattcataaggataaaactattgttgatatacttgaggttatgaatgtaaaaaat
gttggttatataccggtagtagatgatgggaaaaagcttttaggattaataactagaagt
agtctaataaatgttttaagtggacaatttttagatatagatggggtgggaatgtaa

DBGET integrated database retrieval system