KEGG   Clostridium botulinum BKT015925: CbC4_2369Help
Entry
CbC4_2369         CDS       T01475                                 

Definition
(GenBank) putative CoA-substrate-specific enzyme activase
Organism
cbn  Clostridium botulinum BKT015925
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BcrAD_BadFG Hydant_A_N FGGY_C Thymosin
Motif
Other DBs
NCBI-ProteinID: AEB77034
Position
complement(2564709..2565647)
Genome map
AA seq 312 aa AA seqDB search
MGVDVGSVSTDIVLLDEKLNVVEKIYLRTKGKPIQVIQEGIKILQLKYKKDDIKGVGTTG
SGRHIAATLLGADVVKNEITAHAVASLNVNKNVRTIIEIGGQDSKIITLKDGIVTDFAMN
TVCAAGTGSFLDRQAERLEIPIEEFGDYALKSDVAVRIAGRCAVFAESDMIHKQQLGYNQ
SDIIKGLSIALVRNYLNNVGKGKEIKQEVFFQGGVAANKGIKKAFEDELGYKVYVPKNYD
VMGAIGVAIMVSELESFNKTKFKGFEIGESTIISTSFECSGCPNRCEVVNIKDNLKVVGC
FGDKCGKWSENI
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgggagttgatgttggttctgttagtacagacatagtgcttttagatgaaaaattaaat
gttgtagaaaagatatatttgcgaactaagggaaagccaatacaagttatacaggaaggt
attaaaatattacagttaaaatataaaaaagatgatataaaaggggtaggaacaacagga
agtggaagacatatagcagcgactcttttaggtgcggatgtagtaaaaaatgaaataaca
gcacatgctgttgcatctcttaatgtaaataaaaatgttagaacaataatagaaatcgga
ggacaagattctaaaataataacattaaaagatggaatagtaacagattttgctatgaat
actgtatgtgcagcaggaacaggatcatttttagatagacaggcggaaagattagaaata
cctatagaggaatttggtgattatgcattaaagtcagatgtagctgtaagaattgctggc
agatgtgctgtatttgctgaatcagatatgatacataaacagcaattaggatataatcaa
tcggatataattaaaggtttaagtatagcacttgttagaaattatcttaacaatgttgga
aaaggaaaagaaattaaacaagaagtattttttcaaggaggggtagctgcaaataaagga
ataaaaaaagcttttgaagatgaattaggttataaggtgtatgttcctaaaaattatgat
gttatgggagccattggtgtagctattatggtctctgaacttgaaagttttaataagact
aaatttaaaggatttgaaataggagaatctacaattatttctacaagttttgaatgtagt
ggatgtcctaatagatgtgaagttgtaaatataaaggataatttaaaggttgttggatgt
tttggagataagtgtggaaagtggagcgaaaatatataa

DBGET integrated database retrieval system