KEGG   Clostridium botulinum BKT015925: CbC4_2374Help
Entry
CbC4_2374         CDS       T01475                                 

Definition
(GenBank) iron-sulfur cluster-binding protein
Organism
cbn  Clostridium botulinum BKT015925
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_5 Fer4_17 Fer4_9 Fer4_7 Fer4 Fer4_21 Fer4_10 Fer4_18 Fer4_16 Fer4_6 Fer4_4 Fer4_8 Fer4_3 ETF_QO Fer4_2 MerT
Motif
Other DBs
NCBI-ProteinID: AEB77039
Position
complement(2570682..2571233)
Genome map
AA seq 183 aa AA seqDB search
MAAIVCMLGPLILALLGKGRFWCGNICPRGSFYDNIVKKFSNKKRVPGLLKSKIFRVLVI
VFMFYMFGIGIYMNWGNIAGIAMVFYRMIVVTTLVGLILSIFYNHRSWCNFCPMGSIAAF
ISYFKKNRKTLKVNSNCVSCKLCQRKCPMGIVPYDYKGDILKHIDCIQCGECVKYCPKNS
IKY
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atggcagccattgtatgtatgttagggccattaatactagctttattgggaaagggaagg
ttttggtgtggaaatatttgtccaaggggtagcttttacgataatatagtaaaaaagttt
agtaataaaaaaagggttccagggttactaaaatcaaaaatctttagagtgttagttatt
gtattcatgttttatatgtttggaataggtatatatatgaattggggaaatatagctgga
atagcaatggttttttatagaatgatagtagttacaactttagtaggattgatattatct
atattttataatcatagatcttggtgcaatttctgtcctatgggaagtattgctgctttt
atatcatattttaagaagaatagaaaaacattaaaagtaaattcaaattgtgtatcatgt
aagttgtgtcaaagaaaatgtccaatgggaatagttccatatgattataaaggggatatt
ttaaagcatatagattgtatacaatgtggtgaatgtgtaaaatattgtcccaaaaattca
ataaaatattaa

DBGET integrated database retrieval system