KEGG   Clostridium botulinum BKT015925: CbC4_2375Help
Entry
CbC4_2375         CDS       T01475                                 

Definition
(GenBank) conserved hypothetical protein
Organism
cbn  Clostridium botulinum BKT015925
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF488 DUF4116
Motif
Other DBs
NCBI-ProteinID: AEB77040
Position
complement(2571606..2572241)
Genome map
AA seq 211 aa AA seqDB search
MKCYTIGLSTRRLDDFLNLIKIYGIDCIMDIRSNPYSIDKENNVYDKEIIEKYIKQCGIN
YIYMGKELGHERIKGELKESGFSEVIGNSVINKGLHRIVEGIKRGHRIAIMCTEKNPFHC
SRGIVLGYALKNMGIDLEHIISDIKSKTQERIEEEIFITYEPILKKRFVNLTVQDIVEYD
DYDNINAKDIKNIKRMVIEEGYKRKFQELKS
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaaatgttatacaataggactttctactagaagattagatgattttttaaatttaata
aaaatatatggtattgattgtattatggacataagaagtaatccttatagtatagataaa
gaaaataatgtatatgacaaagaaattattgaaaagtatattaaacaatgtggaataaat
tatatatatatgggtaaagagttggggcatgaaagaattaaaggtgaattaaaagagagt
ggttttagcgaggttataggaaatagcgttattaataaaggacttcacagaatagttgaa
ggaattaaaaggggtcatagaatagcaataatgtgcactgaaaaaaatccatttcattgt
agcagagggattgtattggggtatgcattgaaaaatatgggcattgatttagaacatata
ataagtgatataaaatcaaagactcaagaaagaatagaagaagaaatttttataacgtat
gaacctatattgaaaaaaagatttgtaaatttaacagttcaagatatagttgaatacgat
gattatgataatattaatgcaaaagatataaaaaatataaaaagaatggttatagaagaa
ggatataagagaaaatttcaagaattaaaaagttaa

DBGET integrated database retrieval system