KEGG   Clostridium botulinum BKT015925: CbC4_2376Help
Entry
CbC4_2376         CDS       T01475                                 

Definition
(GenBank) DNA helicase, putative
Organism
cbn  Clostridium botulinum BKT015925
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_12
Motif
Other DBs
NCBI-ProteinID: AEB77041
Position
complement(2572268..2572639)
Genome map
AA seq 123 aa AA seqDB search
MSMGVISLLGDEQGELINNLLKSKIGYEEMKNRKIVCGNPYTLQGEERDIIFLSMVISKD
VKFATLTKDADIRRFNVATSRAKRQMWLFHSVNLEDLNEECIRAKLLNYCINFKVINKKL
RIA
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgtctatgggagtaatatccttgttaggagatgagcaaggagaattaataaataatcta
ttaaagagtaaaatcggttatgaagaaatgaaaaatagaaaaatagtttgtggaaatcca
tatacacttcaaggagaggagagagatataatatttttgtctatggttataagtaaagat
gttaaatttgctaccctaactaaagatgcagatataagacggtttaatgtagcaactagc
agagctaaaagacaaatgtggcttttccattcagtaaacttagaggatttaaatgaggag
tgtataagggcaaaactattaaattattgtataaactttaaggttataaataaaaaatta
agaatagcttaa

DBGET integrated database retrieval system