KEGG   Clostridium botulinum BKT015925: CbC4_2377Help
Entry
CbC4_2377         CDS       T01475                                 

Definition
(GenBank) DNA helicase, putative
Organism
cbn  Clostridium botulinum BKT015925
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_12 Helicase_RecD AAA_11 Viral_helicase1 AAA_30 AAA_22 AAA_19 RNA_helicase PhoH Minor_capsid_2 AAA_5 AAA_14 AAA ResIII SRP_SPB AAA_16 IstB_IS21 T2SSE
Motif
Other DBs
NCBI-ProteinID: AEB77042
Position
complement(2572938..2576606)
Genome map
AA seq 1222 aa AA seqDB search
MNSKVTKNILEYKKIFWEKNLVTKGCILKITKSGDRYIEINKKSGEIYNEISKWYTKLLK
EQDNIEIIWGYCFITLKIKNKKIAHPLFSYRCNLIFDEPKDMYILKPINEFQMEIQILDH
MKSNNLDKLLETKNYIENSFKSINKLDDLNKLSKIFSDKLKIKIEKFRKINSNIINYNDI
NIENKIQIYNEPVIIIRNYYKNSWNKELNNMLKMIDHNEYIPDSVKSLVDKNYISTEEDL
KWQDIGKDILYSLPYNKEQLSIGESIAQNFGVVVQGPPGTGKTYSIANLISHLLAHNKRI
LITSTKYKSLEPLINMIPKEIRSLCINYNENKLQNLSQIYHSVISVIEKIQLNSEKTIIE
IKNIQRQLELCRKRKNVIYKKIEISNNLQEKEIHYLGRKYKIRYIEKWLEKYKSQYSWIE
DDISSMKKPPVTDAKFSRLLYIMSNITKDEISQLNDIGGLLYNIPPYYDLFGKIKRKFEI
ERNYNEYKLSVENWCISYNCHYDYEYILKLLNKTQRFLITLEDSWLQNILNCAKRGEVIK
VVLQQAILKCNYYIKKLGSIKKEIYGQSVEIPKDMDLTILLEKLEIIYKQYEQKGKINKI
FRLFHSDCEEVIKKCLVNCKIMDGKESVRTAKLYVEQTIIEQELINLWNDSMSEYGAENI
QEINLEVITNLEEYINKIDIIINWNTKVVDKITNSMKEIVFLNNIDWCNKETYNKLQKGV
MSIKYISEYEGIKSYIGNIEKLMSKVNGFNDIVQAIKENDIVSLKQCYKRIDRLKTIMPS
ITEMEYILEKIEKSCPKLIDRLMDEKDRVNMLIKYKNFSIAWFWKQLDYILKDEYNKFKL
ENINKEIEVEIQREQALIQKLSIKRCWYNTISKISEEEKRSLYSYKEAISRLGKASGKNS
LNYLMLAQQELNNFKKFMPVWIMPLNEVIENLSLSEKLFDVVIMDDAGDMNIFAISALFR
AKKAIIFGDDNEINIENTTQNYKHVKSLTKKYLTDIPNWQWFDMKTSIYSTALRVFPSTV
TLKENLRSLPEIINFSNELCYSNKIITHKDNNIFGELWSAINTVKVDGLRDEDKPINVNE
AKAIVEQIEQCCKNPIYNGMSMGVISLLGDEQGELINNLLKSKIGYEEMKNRKIVCGNPY
TLQGEERDIIFLSMVISKDVKFATLTKDADIRRFNVATSRAKRQMWLFHSVNLEDLNEEC
IRAKLLNYCINFKVINKKLRIA
NT seq 3669 nt NT seq  +upstreamnt  +downstreamnt
atgaattcaaaggttacaaaaaatattttagaatataagaaaattttttgggaaaaaaac
ttagtaactaaaggatgtattttaaaaattacaaaaagtggtgacagatatatagaaata
aacaaaaaaagtggagagatatataatgaaatttcaaagtggtatactaaactattaaaa
gaacaagataatatagaaattatttggggatattgttttattactttgaagataaaaaat
aaaaaaatagcacatcctttgttttcttataggtgtaatctaatttttgatgaaccaaaa
gatatgtatattttgaaacctataaatgagtttcaaatggaaattcaaatattagatcat
atgaaatctaataatttagacaaattattagaaactaagaattacatagaaaatagtttt
aagtctataaataaattagatgatttaaataaattatctaaaatttttagtgataaatta
aagataaaaattgaaaagtttagaaaaataaacagtaatataattaactataatgatatt
aacatagaaaataaaattcaaatatataatgaacctgtcataattataagaaattattat
aaaaattcttggaataaagaattaaataatatgttaaagatgatagatcataatgaatat
atacctgattctgtaaaatcactagttgataagaattatataagtacagaggaagactta
aagtggcaggatataggaaaagatattttatattcattaccttataataaggaacaactt
agtataggtgaaagtatagcccaaaactttggggtggttgttcaaggaccaccaggaaca
ggcaaaacctattctatagcaaatcttatttctcatcttttagcacataacaaaagaatt
ttaataactagtactaaatataaatctcttgaaccattaatcaatatgataccaaaagaa
atcagatctttatgtattaattataatgaaaataaattacaaaatttatctcaaatatac
cattcggtaatcagcgtaatagaaaaaattcaattaaattcagaaaaaacaatcatagaa
attaaaaatatccaaagacaattagagttatgtagaaaaagaaaaaatgttatatataaa
aaaatagagatatctaataatcttcaagagaaggaaattcattatttaggtagaaaatat
aaaataagatatatagaaaagtggttagaaaaatataaaagtcagtattcgtggattgag
gatgatataagttcaatgaagaagccacctgttacagacgctaaattttctagactacta
tatataatgagtaatattactaaagatgaaatttctcaattaaatgatattggagggttg
ttatataatataccaccatattatgatttgtttggaaaaataaaaagaaaatttgaaata
gaaagaaattataatgagtataaattgtcagttgaaaattggtgtatatcatataattgt
cattatgattatgaatatatacttaagttattgaacaaaactcaaagatttttaattaca
ttagaagatagttggttacaaaatattttaaattgtgcaaagaggggagaggtcataaag
gttgtacttcaacaggcaattttgaagtgtaactattatataaaaaaactaggtagtatt
aaaaaggagatatatggtcaaagtgtagagattcctaaagatatggatttaacaatactg
ttagaaaaattagaaattatttataaacagtatgagcaaaaaggtaaaattaataaaatt
tttagattgtttcatagtgattgtgaagaagtaataaaaaagtgtttagttaactgcaaa
ataatggatggaaaagagtcagttaggacagctaagttatatgttgaacaaactataata
gaacaagagttaataaatttatggaatgattcaatgagtgaatatggagctgaaaatata
caagaaataaatttagaggttataacaaatttagaggagtatattaataaaattgatatt
atcattaattggaatactaaggttgtagataaaataactaattcaatgaaagaaattgta
tttttaaacaacatagattggtgtaataaggaaacgtataataaacttcaaaaaggtgta
atgagtattaaatatataagtgaatatgaaggtataaaaagttatataggaaatatagaa
aaattaatgagtaaagttaatggatttaacgacattgtacaagctattaaagaaaatgac
attgtttcactaaaacagtgttacaaaagaatagacaggcttaaaactataatgccaagt
attacagaaatggaatatatattggagaagatagaaaaaagctgtcctaagttaatagat
aggcttatggatgaaaaagatagggttaatatgcttattaaatataaaaactttagtata
gcttggttctggaaacagttagattatatactaaaagatgaatacaataaatttaaatta
gaaaatataaataaagaaattgaagttgaaattcaacgagaacaggcattgatacaaaaa
ttatctattaagagatgttggtataataccatttcaaaaataagtgaagaagaaaaaaga
agtttatattcatataaagaagctattagcagattaggaaaagcatcgggtaaaaattct
ttaaattatttaatgttagcacaacaagaattaaataactttaaaaagtttatgcctgtt
tggattatgccattgaatgaagtcatagaaaatctaagtttatctgaaaaattatttgat
gttgttattatggatgatgcaggtgacatgaatatttttgcaatatctgcattatttaga
gctaaaaaagcgattatttttggtgatgataatgaaattaatattgaaaatactactcaa
aattataaacatgtaaaatcattgacaaaaaaatatttaacagatattcctaattggcag
tggtttgatatgaaaactagtatatattctacagctcttagagtatttccatcaacggta
acattaaaagaaaacttaagatctttacctgaaataattaattttagtaatgagttatgt
tattcaaataagataataacacataaagataacaatatatttggagagttatggtcagct
atcaatactgttaaggttgatggattaagagatgaagataaacctattaatgtaaatgaa
gcaaaagctatagttgaacaaatagaacaatgttgtaaaaatccaatatacaatggaatg
tctatgggagtaatatccttgttaggagatgagcaaggagaattaataaataatctatta
aagagtaaaatcggttatgaagaaatgaaaaatagaaaaatagtttgtggaaatccatat
acacttcaaggagaggagagagatataatatttttgtctatggttataagtaaagatgtt
aaatttgctaccctaactaaagatgcagatataagacggtttaatgtagcaactagcaga
gctaaaagacaaatgtggcttttccattcagtaaacttagaggatttaaatgaggagtgt
ataagggcaaaactattaaattattgtataaactttaaggttataaataaaaaattaaga
atagcttaa

DBGET integrated database retrieval system