KEGG   Clostridium botulinum BKT015925: CbC4_2381Help
Entry
CbC4_2381         CDS       T01475                                 

Gene name
ileS
Definition
(GenBank) isoleucyl-tRNA synthetase
  KO
K01870  isoleucyl-tRNA synthetase [EC:6.1.1.5]
Organism
cbn  Clostridium botulinum BKT015925
Pathway
cbn00970  Aminoacyl-tRNA biosynthesis
Module
cbn_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:cbn00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CbC4_2381 (ileS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cbn01007]
    CbC4_2381 (ileS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cbn03016]
    CbC4_2381 (ileS)
Enzymes [BR:cbn01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.5  isoleucine---tRNA ligase
     CbC4_2381 (ileS)
Amino acid related enzymes [BR:cbn01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CbC4_2381 (ileS)
Transfer RNA biogenesis [BR:cbn03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CbC4_2381 (ileS)
 Prokaryotic Type
   Other AARSs
    CbC4_2381 (ileS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1 Anticodon_1 tRNA-synt_1g tRNA-synt_1e tRNA-synt_1_2 tRNA-synt_1f zf-NADH-PPase
Motif
Other DBs
NCBI-ProteinID: AEB77046
Position
complement(2579132..2582209)
Genome map
AA seq 1025 aa AA seqDB search
MEKNIAKLWKDKDVIQKSFDRNEDGEYFTFYDGPPTANGKPHVGHVLTRVMKDLIPRYKV
MKGYKVLRKAGWDTHGLPVELEIEKKLGISGKPQIEEYGVEKFVTECKDSVFKYTSLWKD
MSEKLGFWVDMDNPYVTYHNTYIESVWWALKTMWEKDLLYKGHRVTPYCPRCGTALSSHE
VAQGYKDVKEATAFVKFKVKGEENKYILAWTTTPWTLPSNVALTINKAYDYVEVLHNDEH
LILAKELASKVLDGEYEIVKEFKGEELLGIEYEQLFKFEVPDKKAFYVVHGDYVTLTDGT
GIVHTAPAYGEDDNMTGKKYDLPLINLVDGEGKFVDAVEPWKGLFVKKADPKILEYMKEN
GSLYKSEKFTHSYPHCWRCDTPLLYYPKDSWFVRMTSLRDKLLENNNKINWNPDNIRTGR
FGKFLENVIDWGISRDRYWGTPLPIWECECGHRECIGSIEELKEKGMNVPDNIELHKPYI
DGVKLNCPHCNKEMTRTNEVIDCWFDSGSMPFAQHHYPFENKEVFEKTFPAQFISEAVDQ
TRGWFYSLLAISTALFDTNSYENCIVLGHVLDKKGLKMSKSKGNVVDPFDVLENEGADAT
RWHFYTASAPWLPTRFSEDDVKETQRKFLSTLWNVYSFYVLYAEIDKFNPTEYKDFVSEN
VMDKWIISKLNTLIKTIGENLDNYKITEAALTLEDFVDELSNWYVRRNRSRFWSTKLTDD
KIGAYTTLHKVLTTLVKVAAPFVPFMSEEIYQNLVVNLDKEAVESVHLCTWPQYNLDTVD
VELERQMDLAYKIVKLGRSARNGANIKNRQPLLEMLVSTKSLPEYYGDIIREELNIKKVE
FGADLSKYVNFEIKPNLPVIGRAYGRYIPAIRKAIASMDQMELAQNIKNGKSVFINVEGL
EDQIELTNENLLVTMQGLEGFAFAGEGGVGVILETTITEELKEEGFVREILSKIQNLRKE
SGFEVADKIKLYFAGNETLENVIKKFEDHIMKETLSVSIDYNEDRTYGEFKINGEELKIA
VEKQA
NT seq 3078 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaaacattgcaaaactttggaaggataaagatgtgattcaaaaaagttttgac
agaaatgaagatggtgaatattttactttttatgatggacctccaacagctaatggtaag
cctcacgtaggacacgttcttacaagagttatgaaagatttaatcccaagatataaggtt
atgaaggggtataaagttttaagaaaagctggatgggatactcatggacttccggttgag
cttgaaattgaaaagaaacttggaatatcaggaaagcctcaaatagaggaatacggtgtt
gaaaaatttgttacagaatgtaaagatagcgtatttaaatacacaagtctttggaaagac
atgtctgaaaagttaggcttctgggttgatatggataatccatatgtaacttatcataat
acttacatagaatcagtatggtgggcattgaagacaatgtgggaaaaggatcttttatat
aaagggcatagagtaacaccatattgcccaagatgtggaactgcattatcttctcacgag
gttgctcaaggttataaagatgtaaaagaagcaactgcgtttgttaaatttaaagttaag
ggtgaagaaaataaatatatcttagcttggactacaacaccttggacattaccaagtaac
gtagctttaactattaataaagcatatgattatgtagaagtattacacaatgatgaacat
ttaatacttgcaaaagaacttgcttcaaaggtattagatggagaatatgaaatagttaaa
gaattcaaaggtgaagagttactaggaatagaatatgaacagttatttaaatttgaagtt
ccagataaaaaagctttttatgtagttcatggtgattatgtaacattaactgatggtact
ggaatagttcatactgcaccggcttatggtgaagatgataatatgacaggaaaaaaatac
gatctaccacttataaacttagttgatggagaaggtaaatttgtagatgcagttgaacct
tggaagggactatttgttaagaaggctgatcctaaaattcttgaatacatgaaagaaaac
ggaagtctttataaatcagaaaaatttactcactcatatcctcattgttggagatgtgat
acaccacttctttattatccaaaagatagctggtttgtaagaatgacatctctaagagat
aaattattagaaaataataataaaataaactggaatccagataacataagaacaggaaga
ttcggtaaattcttagaaaatgttattgattggggtatttcaagagacagatattgggga
acacctcttccaatatgggaatgtgaatgtggtcatagagaatgtattggaagtattgaa
gaattaaaagaaaaaggaatgaatgttcctgataatatagaacttcataagccgtatatt
gatggtgttaaattaaattgtcctcattgtaacaaagaaatgacaagaacaaatgaagtt
attgactgctggtttgattcaggatcaatgccatttgcacaacatcattatccatttgaa
aataaggaagtatttgaaaaaactttcccagctcaatttatatctgaagctgttgaccaa
acaagaggatggttctattcactacttgctatttcaactgccttatttgatacaaattca
tatgaaaattgtatagttttaggtcatgttcttgataaaaaaggccttaaaatgtcaaaa
tcaaagggaaatgttgtagatccatttgatgtacttgaaaatgagggagcagatgctaca
agatggcatttttatactgcaagtgcaccatggcttccaactagattttcagaggatgat
gtaaaagaaactcaaagaaaattcttaagtacattatggaatgtatattcattctatgtg
ttatatgctgaaatagataaatttaatcctactgaatataaagattttgtatcagaaaat
gtaatggataagtggataatatctaaacttaataccttaattaaaactataggagaaaat
ttagataattataaaataactgaagctgctcttacacttgaagattttgttgatgaactt
tcaaattggtatgtaagacgtaatagatcaagattttggtcaactaaacttacagatgat
aagattggagcttatacaactcttcataaagttttaacaacacttgttaaagttgcagca
ccatttgtaccatttatgtcagaagaaatatatcaaaatttagtagttaatttagataaa
gaagctgtagaaagtgttcatttatgtacatggccacaatataatttagatactgtggat
gttgaacttgaaagacaaatggatttagcttataaaatagttaaacttggacgtagtgct
agaaatggagctaatataaagaatagacagccacttttagaaatgcttgttagcacaaaa
tctcttccagagtattatggagatataattagggaagaacttaacataaagaaagttgaa
tttggagcagacctttcaaaatatgttaacttcgaaatcaaacctaatttacctgtgatt
ggaagggcttatggaagatatattcctgctataagaaaggctatagcttcaatggatcaa
atggaacttgctcaaaacataaaaaatggaaaatctgtatttataaatgtagaaggactt
gaagatcaaattgaacttacaaatgaaaacttacttgtaacaatgcaaggacttgaagga
tttgcatttgcaggggaaggtggagttggagtaattcttgaaacaactattacagaagaa
cttaaagaagaaggatttgttcgtgaaatattaagtaaaatccaaaacttaagaaaagaa
agtggatttgaagttgctgataaaataaaactttattttgcaggcaatgagacacttgaa
aatgtaattaagaaatttgaagatcatataatgaaagaaactttatctgtttcaatagac
tataatgaagatagaacttatggggaatttaaaataaacggagaagagttaaaaattgca
gtagaaaaacaagcataa

DBGET integrated database retrieval system