KEGG   Clostridium botulinum BKT015925: CbC4_2382Help
Entry
CbC4_2382         CDS       T01475                                 

Definition
(GenBank) PemK family protein
Organism
cbn  Clostridium botulinum BKT015925
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PemK_toxin Phyto_Pns9_10 DBR1 EST1_DNA_bind
Motif
Other DBs
NCBI-ProteinID: AEB77047
Position
complement(2582957..2583550)
Genome map
AA seq 197 aa AA seqDB search
MKNNINNMSDEELEIFLDKRIETVHQLINQYINLIKDKTRKNHKFKSNKQRAYYINNIYN
YVSWVNEQIKMNENVSRDAKVIPRRGEIWTCELGQNIGSEENKIRPVIIIQNDTGNKNAP
TTIIAPISNRPKKIAVHIELRESDYKLENGEKNHITGTVLLEQIKVVSKARLGRHIATLN
NEFMDILDSKIKISLNL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacaacataaataatatgagtgatgaagaattagaaatatttttagataaaaga
attgaaacagtgcatcagttgataaatcagtatataaatctaataaaagataaaacaaga
aaaaatcataaatttaaatctaataaacaaagagcatattatataaataatatttataat
tatgtatcatgggtaaatgaacagataaagatgaatgaaaatgtatcaagagatgcaaag
gtaatccctagaagaggagaaatctggacttgtgaattaggtcaaaatattggatcagaa
gaaaataaaattagacctgttataataattcaaaatgatactggaaataaaaatgcacct
actacaataatagcacctatatctaatagacctaaaaagattgctgtacatatagaatta
agagaaagcgattataaattagaaaatggagaaaaaaatcatataacagggacggtattg
ttagagcaaataaaagtggtatcaaaagctaggcttggtagacatatagcaactttaaat
aatgagtttatggatattttagactcaaagataaaaatttctcttaatttgtaa

DBGET integrated database retrieval system