KEGG   Clostridium botulinum BKT015925: CbC4_2386Help
Entry
CbC4_2386         CDS       T01475                                 

Definition
(GenBank) Predicted transcriptional regulator, lacI/xre family
Organism
cbn  Clostridium botulinum BKT015925
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_3 HTH_19 HTH_31 HTH_26 HTH_25 YdaS_antitoxin DUF3420
Motif
Other DBs
NCBI-ProteinID: AEB77051
Position
complement(2587574..2588239)
Genome map
AA seq 221 aa AA seqDB search
MSRIGSKIKEARLKSNMTEKQLAKKIGVSEKFIKEVESGKKVINESVMGKISKVLGKDLN
DVTMSFETEVYEEEKVQNTNKKTVEKINDVWNDALGSVLKPVPVYGYDMARIIEMRKLPI
IGNRVEGHAKDKVLFLKVEDDDMIGSRIAKGDVAFGYITHEIENNALCLVEYKGERHIRQ
IKRLDSNKLLLISNGNSLRTETVTVRDIRVLVRLEKIEIKL
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgagcagaattggaagtaaaataaaagaagctagattaaaatcaaatatgacagaaaag
caattagctaaaaagattggagtttctgaaaagtttattaaagaggttgagagtggaaaa
aaggtcataaatgaaagtgttatgggaaaaatatcaaaggtattaggaaaagatttaaat
gatgttacaatgtcttttgaaactgaagtttatgaagaagaaaaagtccaaaatacaaat
aaaaaaacagtagaaaaaataaatgatgtttggaatgatgcattgggatcggttttaaaa
cctgtaccagtttacggatatgatatggctagaattatagaaatgagaaaactaccaatt
atagggaatagagttgaaggacatgctaaagataaagtattgtttttaaaggtagaagat
gatgatatgatagggtctagaatagcaaaaggtgatgttgcttttggttatataactcat
gaaatagaaaacaatgcattatgtcttgttgaatataagggagaaagacatataagacag
attaagagattagacagtaataagttattacttataagtaacggaaatagtttaagaaca
gaaactgttactgtaagagatattagggttttagtaagattagaaaaaatagaaataaaa
ttataa

DBGET integrated database retrieval system