KEGG   Clostridium botulinum BKT015925: CbC4_2400Help
Entry
CbC4_2400         CDS       T01475                                 

Definition
(GenBank) tellurium resistance protein terD
  KO
K05795  tellurium resistance protein TerD
Organism
cbn  Clostridium botulinum BKT015925
Brite
KEGG Orthology (KO) [BR:cbn00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    CbC4_2400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TerD
Motif
Other DBs
NCBI-ProteinID: AEB77065
Position
complement(2603554..2604135)
Genome map
AA seq 193 aa AA seqDB search
MAVSLSKGQKVDLTKTNPGLTKVVVGLGWDINKYDGGNDFDLDAAAFLLDGNAKVTSDGD
FVFYNNLNHDSQSVIHLGDNRTGEGDGDDEKISVELNKVPSNIEKIDFTVTIHDGELREQ
NFGQVSNAFIRIINADTNEELIRYDLSEDYSIETALVVGELYRHNGEWKFNAIGSGFQGG
LGALCNNFGISVG
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggcagttagtttatcaaaaggtcaaaaggtagatttaacaaaaacaaatcctggttta
acaaaggtagtagtaggacttggttgggacataaataaatatgatggtggaaatgatttt
gatttagatgctgcagcctttttattagatggaaatgcaaaggttacatcagatggagac
tttgttttctataataacttaaatcatgattcacaatcagtaattcacctaggagataat
cgtactggagaaggtgatggagatgatgaaaaaataagtgttgaattaaataaagtacct
tcaaatatagaaaagatagattttacagtaactatacatgatggagaattaagagaacaa
aattttggacaagtatctaatgcatttataaggattataaatgcagatactaacgaagaa
ttaataagatatgatttaagtgaagattatagtatagaaacagctttagtagttggagag
ttgtatcgtcacaatggagaatggaaatttaatgctataggaagtggatttcaaggagga
cttggagcgctttgcaataactttggaataagtgtaggttaa

DBGET integrated database retrieval system