KEGG   Clostridium botulinum BKT015925: CbC4_2403Help
Entry
CbC4_2403         CDS       T01475                                 

Definition
(GenBank) xanthine/uracil permease family protein
  KO
K06901  putative MFS transporter, AGZA family, xanthine/uracil permease
Organism
cbn  Clostridium botulinum BKT015925
Brite
KEGG Orthology (KO) [BR:cbn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cbn02000]
    CbC4_2403
Transporters [BR:cbn02000]
 Major Facilitator Superfamily (MFS)
  Sugar transporters
   Purine transporter (AzgA) family [TC:2.A.1.40]
    CbC4_2403
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Xan_ur_permease
Motif
Other DBs
NCBI-ProteinID: AEB77068
Position
complement(2606894..2608192)
Genome map
AA seq 432 aa AA seqDB search
MEKFFALKENNTDVKTEVLAGITTFMTMAYILIVNPAILSDAGMNSGAVFTATAISAVIA
TLIMGLYAKLPFAQAPGMGLNAFFAYNIVKQMGYSFEFALTAVLLEGLIFIALTAFNVRE
AIVDSIPINLKKSISVGIGLLIAFIGLSNAGVVLHPKDNSTILAIGNITSGEALLAIIGI
LISGILLAKNIRGALLIGIIITTIIGIPMGITHLPTAIFSAPPSIKSIAFKFQWQHIFTV
QMAIALFTLLFMDMFDTVGTLVGVATKAKMLDEDGRVPNVKKALFSDAIGTTLGACLGTS
TVSTFVESASGVAEGGRTGLTAVSTAIMFAIALFLSPLFAIIPSAATAPALVLVGLFMME
PIKEIDLVDFTEAIPAFFTIIMMPLAYSISDGIAFGIVSYIFLKALTGKYKEVTLTTYVV
GILFILKFFIPA
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggagaaattttttgcattaaaagagaataataccgatgtgaaaacagaagttttagct
ggtataactacttttatgacaatggcatatatacttattgtaaatccagccatactttct
gatgcaggaatgaattcaggggcggtatttacagcgacagcaatatcagcagttatagca
acactaatcatgggcctttatgcaaagttaccttttgcacaagcaccaggaatgggatta
aatgctttctttgcatataacatagttaagcaaatgggatatagctttgaatttgcatta
acagcagttttattagaaggtcttatattcatagcattaacagctttcaatgtacgcgaa
gctatagttgattctataccaataaacttaaaaaaatctatttccgttggaattggactt
ctaattgcttttattgggcttagtaatgcgggtgttgtattacatccaaaagataatagt
acaatattagctattggcaacataacatctggtgaagctctacttgctataataggaata
ttgataagtggaattttacttgctaaaaatattagaggagcattacttataggaattatc
attactactataattggtataccaatgggtataacacatcttcctacagcaatttttagt
gcgccaccatcaataaaatcaatagcatttaaatttcaatggcaacatatatttactgta
cagatggcaatagctttatttacattattatttatggatatgtttgatacagtaggaact
ttagttggagttgctacaaaagcaaaaatgttagatgaagatggaagagttccaaatgta
aaaaaagcattattctcagatgctataggaaccactttaggagcttgccttggaactagt
acagtaagtacttttgttgaaagtgcatcaggagttgccgaagggggtagaacgggactt
acagcagtatcaacagctataatgtttgcaatagcattattcttatcacctttatttgca
ataattccatcagcagctacagcaccagctcttgtacttgtaggacttttcatgatggag
cctataaaagaaatagatttagtagattttacagaagctattccagctttctttacaata
ataatgatgcctttagcatatagtatatctgatggtatagcatttggaatagtttcatat
atattcttaaaagcgttaacaggaaaatataaagaagttactctaacaacgtatgtggtt
ggaatattatttatattgaaattctttataccagcttaa

DBGET integrated database retrieval system