KEGG   Clostridium botulinum A ATCC 3502: CBO0951
Entry
CBO0951           CDS       T00533                                 

Name
(GenBank) probable transport protein
Organism
cbo  Clostridium botulinum A ATCC 3502
SSDB
Motif
Pfam: ECF_trnsprt ECF-ribofla_trS TMEM174 5TM-5TMR_LYT DUF3810
Other DBs
NCBI-ProteinID: CAL82505
UniProt: A5I0E4
Position
1052198..1052686
AA seq 162 aa
MKTKRLVIMGLFIALSFVGANIKIMGSIAFDSMPAFLGTLILGPIMGAIIGAVAHFLSAL
TSGFPLSLPVHMIVMVDMAVTMILFGIVYNKFKNKNNILAAIVATVVAVIINGPVSVFAI
IPIAGKGVLALLPILSLAALANVIIAIIIYRFIPEKYFQRDK
NT seq 489 nt   +upstreamnt  +downstreamnt
atgaaaactaaaagattagttattatgggattatttatagctttaagttttgtaggtgca
aatataaaaataatgggaagtatagcctttgattctatgccagcatttttaggaacatta
atattaggacctattatgggggccattataggggcagtagctcactttttaagtgcctta
actagtggattcccattaagtttaccagtacatatgatagttatggtagatatggcagta
acaatgatattatttggaatagtttataataaatttaaaaataaaaataatattttagca
gctatagttgcaacagtagtggcagttattataaatggaccagtatctgtgtttgctata
attcctatagcaggtaaaggagtattagctctattaccaatactttctttagcagcttta
gcaaatgtaataatagctattataatatatagatttatacctgaaaaatattttcagaga
gacaaataa

DBGET integrated database retrieval system