KEGG   Clostridium botulinum A ATCC 3502: CBO3200Help
Entry
CBO3200           CDS       T00533                                 

Gene name
thl
Definition
(RefSeq) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cbo  Clostridium botulinum A ATCC 3502
Pathway
cbo00071  Fatty acid degradation
cbo00280  Valine, leucine and isoleucine degradation
cbo00310  Lysine degradation
cbo00362  Benzoate degradation
cbo00380  Tryptophan metabolism
cbo00620  Pyruvate metabolism
cbo00630  Glyoxylate and dicarboxylate metabolism
cbo00640  Propanoate metabolism
cbo00650  Butanoate metabolism
cbo00900  Terpenoid backbone biosynthesis
cbo01100  Metabolic pathways
cbo01110  Biosynthesis of secondary metabolites
cbo01120  Microbial metabolism in diverse environments
cbo01130  Biosynthesis of antibiotics
cbo01200  Carbon metabolism
cbo01212  Fatty acid metabolism
cbo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cbo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CBO3200 (thl)
   00630 Glyoxylate and dicarboxylate metabolism
    CBO3200 (thl)
   00640 Propanoate metabolism
    CBO3200 (thl)
   00650 Butanoate metabolism
    CBO3200 (thl)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CBO3200 (thl)
   00072 Synthesis and degradation of ketone bodies
    CBO3200 (thl)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CBO3200 (thl)
   00310 Lysine degradation
    CBO3200 (thl)
   00380 Tryptophan metabolism
    CBO3200 (thl)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CBO3200 (thl)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CBO3200 (thl)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CBO3200 (thl)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cbo04147]
    CBO3200 (thl)
Enzymes [BR:cbo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CBO3200 (thl)
Exosome [BR:cbo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CBO3200 (thl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SpoVAD ACP_syn_III ACP_syn_III_C
Motif
Other DBs
NCBI-GeneID: 5187759
NCBI-ProteinID: YP_001255689
UniProt: A5I6S9
Position
complement(3408916..3410109)
Genome map
AA seq 397 aa AA seqDB search
MGVWKMKNVVIASAVRTPIGKFGGTLKSVSAIELGSIVIKEALKRANVKPEDVDEVIMGN
VLQAGLGQNSTRQSAVAAGIPVEVPSFTINKVCGSGLRAVSLATQLIKLGDDDIVVAGGT
ENMSAAPYLLEKARWGQRMGDGKIVDEMIRDGLWESFNDYHMGITAENIAEQWGITREEQ
DEFSAKSQQKAEKAVKEGRFKEEIVPVVIKSRKGEVVFDTDEFPRFGATKESLSKLKPAF
KKDGTVTAGNASGINDGAAALVIMSEEKANELGIKPLAKIVAYGTSGVDPKIMGYGPFYA
TKKTLEKANLKIADMDLIEANEAFAAQSLAVAKDLGFDMDKVNVNGGAIALGHPIGCSGA
RILTTLLYEMEKRNSKHGLATLCIGGGMGTAIIVERY
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
ttgggggtatggaaaatgaaaaatgttgttattgctagtgctgtaagaacacctatagga
aaatttggaggaacattaaaaagtgtttcagctatagaattaggaagtattgttattaaa
gaagctttaaaaagagctaatgtaaaaccagaagatgttgatgaggttataatgggtaat
gtacttcaagcaggtcttggtcaaaactcaacaagacaatctgcagtagcggcaggtata
ccagtagaagtaccaagctttacaataaataaggtttgtggttcaggacttagagcagta
agtttagcaactcaattaataaaactcggagatgacgatatagtagtagcaggtggtaca
gaaaatatgtctgcagctccatatcttttagaaaaagcaagatggggacagagaatggga
gatggaaaaattgtagacgagatgataagagatggactatgggaatcttttaatgactat
catatgggaattacggctgaaaatatagcagagcaatggggaataacaagagaagagcaa
gacgaattttcagctaaatcacaacaaaaagcagagaaagctgtaaaagaaggaagattt
aaagaggaaatagtaccagtagttattaaaagtagaaaaggcgaagtagtatttgatact
gatgaatttcctagatttggtgctactaaagagagcctttctaaattaaaaccagctttc
aaaaaagatggaacagttacagctggtaatgcttcaggtataaatgatggagcagctgct
ttagttatcatgagtgaagaaaaggcaaatgaattaggaattaaacctttagctaaaata
gttgcttatggtacaagtggagtagatccaaagataatggggtatggaccattttatgca
actaaaaaaactttagaaaaagccaacctaaaaatagcagatatggatttaatagaagca
aatgaagcttttgcggctcaaagtttagcagtagctaaagatctaggttttgatatggat
aaagtaaatgtaaatggtggagctatagctttaggacatccaattggatgctcaggggct
agaatattaactactttattatatgaaatggaaaaaagaaattcaaaacatggcttagct
accttatgtataggcggtggaatgggaacagctattattgttgaaagatattaa

DBGET integrated database retrieval system