KEGG   Clostridium botulinum A ATCC 3502: CBO3373Help
Entry
CBO3373           CDS       T00533                                 

Gene name
pfkA
Definition
(RefSeq) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cbo  Clostridium botulinum A ATCC 3502
Pathway
cbo00010  Glycolysis / Gluconeogenesis
cbo00030  Pentose phosphate pathway
cbo00051  Fructose and mannose metabolism
cbo00052  Galactose metabolism
cbo00680  Methane metabolism
cbo01100  Metabolic pathways
cbo01110  Biosynthesis of secondary metabolites
cbo01120  Microbial metabolism in diverse environments
cbo01130  Biosynthesis of antibiotics
cbo01200  Carbon metabolism
cbo01230  Biosynthesis of amino acids
cbo03018  RNA degradation
Module
cbo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cbo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CBO3373 (pfkA)
   00030 Pentose phosphate pathway
    CBO3373 (pfkA)
   00051 Fructose and mannose metabolism
    CBO3373 (pfkA)
   00052 Galactose metabolism
    CBO3373 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    CBO3373 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    CBO3373 (pfkA)
Enzymes [BR:cbo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CBO3373 (pfkA)
Protein phosphatases and associated proteins [BR:cbo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CBO3373 (pfkA)
Messenger RNA biogenesis [BR:cbo03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     CBO3373 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-GeneID: 5184682
NCBI-ProteinID: YP_001255855
UniProt: A5I798
Position
complement(3607422..3608381)
Genome map
AA seq 319 aa AA seqDB search
MRTIAVLTSGGDAPGMNAAIRAVVRTGLEKGLKVMGIQRGYNGLINGEIFEMDTHSVSDI
IQRGGTILRTARCEEFRTEQGREKAAKILKAFGIDGLVVIGGDGSFHGAQLLSKLGINTV
GLPGTIDNDLAYTDYTIGFDTSINTVLDAINKLRDTSTSHERVSVVEVMGRNCGDIALYT
GVAGGAESIIIPEKEYNADKLCKQILQGKLKGKMHNLVLLAEGVGGANELAKYIEEVTGI
ETRSTILGHIQRGGSPTCMDRILASRMAYKAVELLISGKSSRVVGIKNGKIIDMDIDEAL
AVERSFDQELYDIATILSK
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgagaactatagctgtattaacaagtggtggagatgcaccaggaatgaatgctgctatc
agagcagtagttagaacaggtttagaaaaaggtttaaaagtaatgggaattcaaagagga
tataacggacttataaatggagaaatatttgaaatggatactcatagcgtatctgatata
atacaaagaggcggaactatattaagaacagctcgttgtgaagaatttagaacagagcag
ggaagagaaaaagctgctaaaatattaaaagcctttggtattgatggattagttgtaatt
ggtggagacggttcttttcatggggcccaattattatctaagttaggaataaatactgtt
ggactaccaggtactatagataatgatttagcttatacagattatacaattggctttgat
acatctataaatacagttttagatgctataaataagcttagagatacatccacttctcat
gaaagagtaagtgtagtagaagttatgggaagaaattgtggagatatagcattatataca
ggagtagctggtggagcagaaagtattataataccagaaaaagagtataatgcagataaa
ttatgcaaacaaatactacaaggaaaattaaaagggaaaatgcataacttagttttatta
gcagaaggtgttggaggagctaatgaactagcaaaatatatagaagaggttacagggata
gaaacaagatctacaatattaggacatatacaaagaggtggaagcccaacttgtatggat
agaatattagcttcaagaatggcttataaggcagtagaattattgattagtggtaaatct
tcaagagtagttggtataaaaaatggaaaaataattgatatggatatagatgaagcttta
gcagtagaaagaagttttgaccaagaattatatgacatagcaactattttatccaaataa

DBGET integrated database retrieval system