KEGG   Clostridium bolteae: CGC65_20790Help
Entry
CGC65_20790       CDS       T05466                                 

Gene name
selD
Definition
(GenBank) selenide, water dikinase SelD
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
cbol  Clostridium bolteae
Pathway
cbol00450  Selenocompound metabolism
cbol01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbol00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CGC65_20790 (selD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cbol03016]
    CGC65_20790 (selD)
Enzymes [BR:cbol01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     CGC65_20790 (selD)
Transfer RNA biogenesis [BR:cbol03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    CGC65_20790 (selD)
 Prokaryotic Type
    CGC65_20790 (selD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: ASN96869
UniProt: A0A412Z816
Position
4496801..4497841
Genome map
AA seq 346 aa AA seqDB search
MSDIKLTELTGSCGGUASKIGPDTLAQVLRGLPTFHDDRLLVGYDTSDDAAVYQLTPELA
LIQTVDIFPPAVDDAYEYGQIAAANSLSDVWAMGGEARLCMNILMFPEHLPFETVQAILR
GGYDKVAEAEAIVVGGHTIKDDIPKYGLCVSGVVHPDRILRNNSIQKGDVLILTKPLGTG
VLTNADRGGLLSDSEHKAMVDCMAALNKYAADAVRNLDGVHACTDVTGFSLLGHSYEMCG
ESGLTVIIDSSRVPLLPGADSYASMGLVPAVAYQNMNHLKDKVALPKDLPSHVHDLLFDP
QTSGGLLYSVASQEAGRIMEALQKACQSPAVIGHVDGPSAHPVMVI
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatattaaactgactgagttaacaggttcctgcggcggctgagcgtccaagata
gggcctgataccctcgcgcaggttctgcgcggtttaccaacctttcacgacgaccggctt
ctggttggatatgacacctccgacgatgcggccgtctatcagcttacccctgaacttgcc
ctgatacagaccgtggacatctttccgccggctgtggatgatgcctatgagtacggccag
attgccgctgccaactcactgtccgacgtatgggccatgggcggggaagccagactatgc
atgaacattctcatgttccctgagcacctgccctttgaaacggttcaggctatcctccgg
ggcggctatgacaaggtggctgaagctgaggccattgtagtgggcggccataccatcaag
gatgacatccccaaatatggactgtgcgtctcaggcgtggtccatccggaccgcatcctg
cgcaataattccatccaaaagggcgatgttctgattctcaccaaacctctgggcaccggc
gttctgaccaatgcggacaggggcggccttttatctgactcagaacataaggccatggtt
gactgtatggctgcgctgaataagtatgcagccgatgcggtacgaaacctggacggggtc
catgcctgcaccgatgtgaccggcttctcactgctgggccacagctatgagatgtgcggg
gaatccggacttactgtaatcatagacagcagccgcgtccctctgctcccgggtgcggac
agctatgcgtccatgggacttgtgcccgcagtggcataccagaatatgaatcacctgaag
gataaggtagcgctgccaaaggaccttccgtcccatgtacacgaccttcttttcgatccc
cagacatccggcggcctcctgtacagtgtggcatcccaggaagcagggcgtatcatggaa
gcgcttcagaaagcctgccagtccccggctgttatcggacatgtggacgggccatccgcc
cacccggtcatggtgatttga

DBGET integrated database retrieval system