KEGG   Enterocloster bolteae: CGC65_21650
Entry
CGC65_21650       CDS       T05466                                 

Definition
(GenBank) xanthine dehydrogenase molybdenum-binding subunit XdhA
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
cbol  Enterocloster bolteae
Pathway
cbol00230  Purine metabolism
cbol01100  Metabolic pathways
cbol01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cbol00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CGC65_21650
Enzymes [BR:cbol01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     CGC65_21650
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: ASN97025
UniProt: A0A412Z8C2
Position
complement(4670681..4672969)
AA seq 762 aa
MGIGKNMTRVDAFDKVTGSARYTADLEPQGLLVAKVIRSTIANGVVKSFDLEEARKVPGV
VKIVTCFDVPDIQFPTPGHPWSVETAHQDIADRKLLNTRVRVYGDDIAAVIAEDDIAAAR
AARLVKVEYEEYAPLLTVEDAMAEGASRLHDEKPGNVIAHSSFVVGEGTYGEAVKEEGLV
EIEKDYRTQSVQHCHIETPISFAYMEKGRIIVTTSTQIPHIVRRVISQALGLPMGRIRVI
KPYIGGGFGNKQDVLYEPLNAFLTTQVGGRGVRMEISREETLGCTRVRHAIEFKVKAAAR
KDGTLVARKLEAYSNQGGYASHAHAIVANSSNEFKQIYKDEKVLESDAWTVYTNLATGGA
MRGYGIPQAAFAAECMADDLALALHMDPLEFRKKNCMRPGYVDPHTHVKCNTYGLAECME
KGREFIRWDEKRREYENQTGPVRKGIGMAIFCYKTGVYPISLETASCRMILNQDGSMQLQ
MGATEIGQGADTVFTQMAAEVTGITEDKVNVLSTQDTDVSPFDTGAYASRQTYVSGMAVK
KTGAIFKEKILDYAAYMLEKPQDTLDVRDNHIVDKETGTQLLPMEELATTAFYSLDRSVH
ITAEATSHCKTNTFATGACFAEVEVDMPLGKVKVTNIVNVHDSGKLINPKLAAAQVHGGM
SMGLGYGLSEELLFDAKGRPLNDNLLDYKLPTAMDTPDLNALFVELDDPTGPFGNKALGE
PPAIPVAPAVRNAVLNATGVAVDSLPMDPQKMVKHFKEAGLI
NT seq 2289 nt   +upstreamnt  +downstreamnt
atgggaattggtaaaaacatgacccgcgttgacgcatttgacaaagtcacaggcagtgcc
aggtatacagccgatttagagccacagggtcttctggtggcaaaggtaatacgcagcacc
atcgccaacggcgtggtaaaaagctttgatttggaagaagcacggaaggtgccgggggta
gtgaagattgtaacgtgcttcgatgtaccggacatccagttccccacacccggccatcca
tggtccgtggaaacggcccatcaggatattgcggacaggaaacttctcaataccagggtg
cgggtctatggagacgatattgcagccgtgatagcggaggacgatatagcggcagccagg
gcagccaggcttgtgaaggtggagtatgaggagtatgctcccctgctgaccgtggaggac
gccatggcagagggcgcatcccgacttcacgatgaaaaaccgggaaatgtcattgcccat
tcttcttttgtggtgggcgaagggacttacggggaagcagtgaaggaggagggactggtg
gagatagaaaaggactaccggacccagagcgtgcagcactgccacatagaaacgcccatc
tcctttgcctatatggaaaagggaagaatcatcgtcaccacatccacacagatcccccat
attgtgcgccgtgtcatcagccaggcgctgggactgcccatgggccgtatccgtgtgata
aagccctacatcggcggcggattcggcaacaagcaggatgtactctatgagcccttaaat
gctttccttaccacccaggtgggaggaagaggggtcaggatggagatatccagggaagaa
actctgggatgtaccagggtgcgccatgccatcgagttcaaggtaaaggcagcggccagg
aaggacggcacgctggttgccaggaagctggaggcatattccaaccagggcggatacgcg
tcccatgcccatgccatcgtagccaactcctccaatgagttcaagcagatttacaaggat
gagaaggtgctggagtccgatgcctggactgtgtacaccaatctggccacgggcggcgcc
atgaggggatacggaattccccaggcagcgtttgccgcggaatgcatggcagacgacctg
gccctggcccttcacatggacccgttggaattcaggaaaaagaactgcatgaggccggga
tacgttgacccccacactcatgtgaaatgcaatacatacggcctggcggaatgtatggaa
aagggccgggaattcatccgctgggatgagaaacgcagggaatatgaaaaccagacagga
cccgtgcgaaagggaatcggtatggctatcttctgctataagacaggcgtatatcccata
tccctggaaacagcatcctgccgcatgatactgaaccaggacggctccatgcagctgcag
atgggggcaacggaaatcggccagggcgccgacaccgtgtttacccagatggcggcagag
gtgaccggaatcacggaagataaggtaaatgtgctgtccacccaggatacggacgtaagc
ccctttgataccggcgcatatgcttccaggcagacctatgtcagcggtatggcagtgaag
aaaaccggcgctatatttaaggaaaagatactggattacgctgcttatatgctggagaag
ccccaggataccctggatgtgagggataaccacattgtggataaggagaccggaacgcag
ctgttgcccatggaggagctggccaccacggcattttacagcctggaccgctccgtacat
atcacggcagaggccaccagccattgcaagaccaatacatttgccacgggtgcctgcttt
gcggaggtggaggtggatatgcctttgggcaaggtgaaggtgaccaatatcgtcaatgta
catgacagcggaaaactgattaaccccaagctggctgctgcccaggtacacggcggcatg
agcatgggactgggctacggactcagcgaggagctgctctttgacgcaaaggggagaccg
ttaaacgacaatttgctggattataagctgcccacagccatggatactccggacttaaac
gcactctttgtggagttggatgatcccacaggtccctttggaaataaggcgcttggggag
ccgccggcgattccggttgccccggctgtgcgcaacgcagttcttaacgccacaggcgtt
gcagtggacagtctgcccatggatccacagaagatggtgaagcatttcaaggaagcggga
ttaatatag

DBGET integrated database retrieval system