KEGG   Caulobacteraceae bacterium OTSz_A_272: ATE48_02065Help
Entry
ATE48_02065       CDS       T04422                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
cbot  Caulobacteraceae bacterium OTSz_A_272
Pathway
cbot00480  Glutathione metabolism
cbot00590  Arachidonic acid metabolism
cbot01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbot00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    ATE48_02065
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ATE48_02065
Enzymes [BR:cbot01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     ATE48_02065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: ANP44793
UniProt: A0A1B1AE17
Position
complement(398304..398783)
Genome map
AA seq 159 aa AA seqDB search
MSSIYDFTARDIDGNERSLGEYRGKLLLIVNTASQCGFTYQYKGLEELHRKYAAQGVEVL
GFPCNQFGKQEPGDANEIKNFCSLTYDVTFPMFAKIDVNGPKAHPLYEHLTRAKGGGLLG
RGIKWNFTKFLIGRDGKVLARYAPTVKPEALDKVIQRHL
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcatttacgattttaccgcgcgtgacatcgacggaaacgagcgctcgctagga
gagtatcgcggcaaactgctgctcatcgtaaatacggcgagccaatgcggcttcacatat
cagtacaaaggcctcgaagaattgcaccgcaagtacgcggcgcagggcgtcgaggtgttg
ggtttcccttgcaatcaattcggcaagcaggagccgggcgacgcgaatgagatcaagaat
ttctgttctctcacgtatgatgttacgttcccgatgtttgccaagatcgacgtcaacggc
cccaaggcgcatccgctctacgagcacctgacgcgcgccaaaggcggcggcctgctcggt
cgcgggatcaaatggaatttcacaaagtttctgattggccgcgatggcaaagtgctggcg
cgttacgcgccgacggtgaagccagaagcgctcgacaaagtaatccagcgccacctctga

DBGET integrated database retrieval system