KEGG   Caulobacteraceae bacterium OTSz_A_272: ATE48_02205Help
Entry
ATE48_02205       CDS       T04422                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cbot  Caulobacteraceae bacterium OTSz_A_272
Pathway
cbot00071  Fatty acid degradation
cbot00072  Synthesis and degradation of ketone bodies
cbot00280  Valine, leucine and isoleucine degradation
cbot00310  Lysine degradation
cbot00362  Benzoate degradation
cbot00380  Tryptophan metabolism
cbot00620  Pyruvate metabolism
cbot00630  Glyoxylate and dicarboxylate metabolism
cbot00640  Propanoate metabolism
cbot00650  Butanoate metabolism
cbot00900  Terpenoid backbone biosynthesis
cbot01100  Metabolic pathways
cbot01110  Biosynthesis of secondary metabolites
cbot01120  Microbial metabolism in diverse environments
cbot01130  Biosynthesis of antibiotics
cbot01200  Carbon metabolism
cbot01212  Fatty acid metabolism
cbot02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cbot00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ATE48_02205
   00630 Glyoxylate and dicarboxylate metabolism
    ATE48_02205
   00640 Propanoate metabolism
    ATE48_02205
   00650 Butanoate metabolism
    ATE48_02205
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ATE48_02205
   00072 Synthesis and degradation of ketone bodies
    ATE48_02205
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ATE48_02205
   00310 Lysine degradation
    ATE48_02205
   00380 Tryptophan metabolism
    ATE48_02205
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ATE48_02205
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ATE48_02205
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ATE48_02205
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cbot04147]
    ATE48_02205
Enzymes [BR:cbot01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ATE48_02205
Exosome [BR:cbot04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ATE48_02205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ANP44820
UniProt: A0A1B1AE34
Position
418952..420178
Genome map
AA seq 408 aa AA seqDB search
MAIYLLGGHQTDFARAWSREGLDFTDMMREAIDGALAATNLDAGDIDAIHVGNAFGELYR
NQGHLAAMVAQVKPEFYGKPAMRHEAACASSSIAVLTATAEIEAGRYDCVLILGVEEEKN
LPGDEASKIQNAASWQGREDIDCRFMWPAVFGRIAQEYDERYGLDRRYLNRISEINRTNA
LRNPWAQTRKWRFDPEAFTDNDELNPIIEPGTRRQDCGQITDGAAAIIVASDRFIENYAQ
KRGAKPSDFPQITGWGHANAGIRFLDKIERSRGQQYMFPHVRQAIADAWKRANISGASGL
DGIELHDCFTSTEYMAIDHFGFADPGESWRAIEDGTIAMGGACPVNASGGLIGVGHPVGA
TGVRMLLDAGRQVTGTAGDYQVEGARTYQTLNIGGSLGTVVSFVVART
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atggcgatctatctgctcggcggacatcaaactgattttgcgcgcgcatggtcgcgtgaa
ggcttggacttcaccgatatgatgcgcgaggcgatcgatggcgccctcgccgcaaccaat
ctcgacgcgggcgacattgatgcaatccatgtcggcaatgcattcggcgaactttatcgc
aaccagggccacctcgcggcgatggtcgcgcaagtgaagccagagttctacggcaagccg
gccatgcgtcacgaagcggcctgcgcttcaagttcgatagcggtgctcactgcaaccgcc
gaaatcgaagctggccgttacgactgcgtgctcattcttggcgttgaagaagaaaagaac
ctgccaggcgacgaagcttcgaagatccagaacgccgcctcctggcaagggcgcgaggac
atcgactgccgtttcatgtggccagctgtgttcggacgcatcgcgcaagaatacgacgaa
cgctacggcctcgatcggcgctatctcaatcgcatttccgaaatcaatcgcaccaacgcg
ctacgcaatccgtgggcgcagacgcgcaaatggcgcttcgatcctgaagccttcaccgac
aacgatgaactgaacccgatcatcgagcccggcacacgccgccaagattgcggtcagatc
acggatggcgctgccgccatcatcgtcgcgtcagatcgcttcatcgaaaattacgctcag
aaacgcggcgcaaaaccctctgactttccgcagatcaccggctgggggcacgccaacgct
gggattcgctttctcgacaagatcgaacgcagccgcggccagcagtacatgttcccgcac
gtacgccaggccatcgccgacgcctggaaacgtgcaaacatatccggcgcctcggggctc
gacggcattgagctgcacgactgcttcacctcaactgaatatatggcgatcgaccatttc
ggtttcgccgaccccggcgaaagctggcgcgcaattgaagacggcacgatcgccatgggc
ggtgcttgtccggtcaatgcttcaggcggcttgatcggcgtcggccaccccgtcggcgca
acgggcgttcgaatgttgctcgatgctggacgccaagtcacaggcacagcgggcgattac
caagtcgaaggcgcgcgcacttaccaaacgctgaacatcggcggctcgctcggcaccgtc
gtcagcttcgtcgtcgcgcgaacttaa

DBGET integrated database retrieval system