KEGG   Caulobacteraceae bacterium: ATE48_03355
Entry
ATE48_03355       CDS       T04422                                 

Definition
(GenBank) hypothetical protein
  KO
K17899  D-ornithine 4,5-aminomutase subunit alpha [EC:5.4.3.5]
Organism
cbot  Caulobacteraceae bacterium
Pathway
cbot00472  D-Arginine and D-ornithine metabolism
cbot01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbot00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    ATE48_03355
Enzymes [BR:cbot01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     ATE48_03355
SSDB
Motif
Pfam: DUF2749 Nodulin-like
Other DBs
NCBI-ProteinID: ANP45024
UniProt: A0A1B1AEP7
Position
639733..640041
AA seq 102 aa
MIALVVTKLDSERGQSLSVYLMTGAVAAIAGASVGLAAVLVATSPAKIVVLFAAALIGAF
QGAAVVWFIVGPDLALPPAWSNDPKTRDEREDGTPNPPTAAP
NT seq 309 nt   +upstreamnt  +downstreamnt
ttgatcgcactagtcgtgaccaagttggacagcgaacgtggtcaatccctatcagtctat
ctgatgacaggcgctgtcgcggcgatcgcaggcgctagcgtcgggcttgctgccgtgctc
gtcgccacgtcaccagcaaagattgtcgttttatttgctgcggctctcatcggcgcattt
caaggcgcggccgtcgtttggttcatcgtcggaccagaccttgcccttccaccagcttgg
agcaatgatccaaaaactcgggacgagcgcgaagacggaacaccgaatccgcctacagcc
gcgccatga

DBGET integrated database retrieval system