KEGG   Caulobacteraceae bacterium OTSz_A_272: ATE48_16880Help
Entry
ATE48_16880       CDS       T04422                                 

Definition
(GenBank) tryptophan 2,3-dioxygenase
  KO
K00453  tryptophan 2,3-dioxygenase [EC:1.13.11.11]
Organism
cbot  Caulobacteraceae bacterium OTSz_A_272
Pathway
cbot00380  Tryptophan metabolism
cbot01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbot00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    ATE48_16880
Enzymes [BR:cbot01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.11  tryptophan 2,3-dioxygenase
     ATE48_16880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_dioxygenase Hs1pro-1_C
Motif
Other DBs
NCBI-ProteinID: ANP48133
UniProt: A0A1B1ANI3
Position
complement(3294610..3295401)
Genome map
AA seq 263 aa AA seqDB search
MSKGVTYGSYLRLPELLAAQTPQTGEHDELLFVILHQTMELWMKQAIHEIGAAQREVQSG
NLVPAYKHLARVSRIQAVMTQAWDILATMTPADYLSFRNLLGTSSGFQSAQFRVLEYKLG
IKDPSFLKFHEDGGADRKMLDEALSAPSLYDDVLRQLAGAGFNVPASSYNRASGAPYEPS
DAVETAWLAVYRDTTKYWALYQLAEKLIDLDDALLTWRHKHVLTVERIIGRKRGTGGTEG
VGYLQQTLTRRAFPEIWSLRTKL
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaggcgtcacatacggaagctatctgcgtttgccggaacttttggcggcccag
acaccccaaaccggcgaacacgacgagcttctcttcgtcatcctgcaccagaccatggaa
ctttggatgaagcaggcgatccacgaaatcggcgccgcccaacgcgaagtgcaatctggc
aatctcgttccggcctataaacatttggcgcgcgtctcgcgcatccaagcagtgatgacc
caagcctgggacatcctcgcgacgatgacgccagccgattatctcagcttccgcaatctt
ctcggcaccagttcaggctttcaatccgcgcagttccgcgtcctcgaatacaaactcggc
atcaaggatccgagcttcctcaaatttcacgaggacggcggcgccgatcgcaagatgctg
gacgaggcgctaagcgccccaagtctctatgacgacgtattgcgccaacttgcgggtgcg
ggcttcaacgttcccgcatcatcatacaaccgcgcctcaggcgcgccctatgagccaagc
gacgcggtcgagaccgcatggctcgccgtctatcgggacaccactaagtattgggcgctt
tatcagctcgcggaaaagctcatcgatctcgatgatgcattgctgacctggcggcacaag
catgtgctcacagtagagcgcatcatcggacgcaagcgtggcaccggtggcaccgagggc
gtcggctatttgcaacagacgctgacacgccgcgcctttcctgaaatttggtcgcttcgg
acgaaactatga

DBGET integrated database retrieval system