KEGG   Caulobacteraceae bacterium OTSz_A_272: ATE48_18795Help
Entry
ATE48_18795       CDS       T04422                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
cbot  Caulobacteraceae bacterium OTSz_A_272
Pathway
cbot00450  Selenocompound metabolism
cbot00970  Aminoacyl-tRNA biosynthesis
cbot01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbot00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ATE48_18795
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ATE48_18795
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cbot01007]
    ATE48_18795
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cbot03016]
    ATE48_18795
Enzymes [BR:cbot01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     ATE48_18795
Amino acid related enzymes [BR:cbot01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   ATE48_18795
Transfer RNA biogenesis [BR:cbot03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    ATE48_18795
 Prokaryotic type
   Other AARSs
    ATE48_18795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 Anticodon_1 tRNA-synt_1f DZR zinc_ribbon_4
Motif
Other DBs
NCBI-ProteinID: ANP47799
UniProt: A0A1B1AMK0
Position
3663579..3665291
Genome map
AA seq 570 aa AA seqDB search
MARYLITSALPYINGIKHLGNLAGSMLPADIHARFRRLQGHEVLFICATDEHGTPAELAA
AEAGQDVAAYCAEQYKIQKDACDGFKLSFDHFGRSSNAPNHKLTQHFCEVLEKNGLIEER
VSKQIYSIDDKRFLPDRYVEGTCPHCGFERARGDQCDNCGTLLDPVDLINPRSKISGSTN
VEPRDTAHLFLKQPKMQDEIRAWVDKSTEWPTLARSIAYKWLDEGLIDRSITRDLSWGIK
VTQDAKPRPGFENKVFYVWFDAPIEYIGASVEWADATGGNWERWWRTDKGADDVTYIQVM
GKDNVAFHTVSFPVTIMGSQEPWKLVDRLKAFNWVTWYGGKFSTSEKRGIFMDQALAILP
SDYWRWYLMANAPESSDAAFTLEQFQQTINADLANVFGNFINRITRFAASKFDSEVPDGG
APGPYEEKLANEFAERLAALTQFHDQMEYRKAAAELRAIWVAGNEYLQVAAPWTALKTDR
DAAAVSVRTGLNACALFAILAQPFIPDAAKVVLDAIGVPVKNRMWPKPEDRSVWDALPRG
LKFSPPDVLFKKIEDEHVAELAERFGGGGA
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atggcccgctacctgatcacgtccgcactcccctacatcaacggcatcaagcatctcggc
aatctggcgggctcgatgctgcctgcggatattcacgcgcgctttcgccgtctgcagggg
cacgaagttctcttcatttgcgcgactgatgagcatggcacgccggccgaactagctgcg
gccgaagccgggcaggacgtcgcggcgtattgcgccgagcaatacaaaatccagaaagac
gcgtgcgacggcttcaagctgtcgttcgaccatttcggccgctcttccaatgcgccgaac
cacaagctcacgcagcatttctgcgaagtgctcgaaaagaacgggctgatcgaagagcgc
gtttcgaagcaaatctattcaatcgatgacaagcgctttttgccggatcgctatgttgaa
ggcacgtgcccgcattgcggctttgaacgtgcgcgcggcgatcagtgcgacaattgcggc
acgctgctggacccagtcgatctcatcaatccgcgttccaagatttctggttcgacgaat
gtcgagccacgcgacaccgcacacctctttctcaaacagccgaagatgcaggatgagatc
cgtgcatgggtcgacaagtccaccgaatggccgacgcttgctcgttcgattgcctacaaa
tggctcgatgaagggctgatcgatcgctcgatcacccgcgacctctcttgggggattaaa
gtcacccaggacgctaagccgcgtccgggcttcgagaacaaggtgttctacgtctggttc
gatgcgccgatcgagtacatcggagcgagcgtcgagtgggccgacgccactggcggcaat
tgggagcgctggtggcgcaccgataagggcgccgatgacgtcacctacattcaagtgatg
ggcaaggataacgtcgctttccacaccgtaagcttccccgtgacgatcatgggaagtcag
gagccgtggaagcttgttgatcgcttgaaagccttcaactgggtcacttggtatggcggc
aaatttagcaccagtgaaaagcgcgggatattcatggaccaagcgctcgcgattttgccg
agcgactattggcgctggtatttgatggccaacgcgccggaaagctctgatgcggcgttc
acgcttgagcaattccagcaaaccatcaatgccgaccttgccaacgtgtttggcaacttc
atcaatcgcatcacgcgatttgcggcttcgaagttcgatagcgaagtgcccgatggcggg
gcgcccggcccctacgaagaaaagctcgcgaacgaatttgccgagcgcttggcggcgctg
acgcagttccacgatcagatggagtatcgcaaagctgcggcggagctccgtgcgatttgg
gtcgccggtaacgagtatctccaagtcgcagcgccatggaccgccttgaagaccgatcgc
gatgcggcagctgtcagcgtgcgcactgggctgaatgcttgcgcgttgttcgcaattctc
gcgcagcccttcattcccgatgctgcgaaggtcgtgctggacgcgatcggcgtgccggtg
aagaaccgcatgtggccgaagcccgaggatcgcagtgtgtgggacgctctgccgcgcgga
ctgaagttctcgccgccagacgtgctcttcaagaagatcgaggacgagcacgtcgctgag
cttgccgagcgcttcggtggtggcggcgcgtga

DBGET integrated database retrieval system