KEGG   Lawsonella clevelandensis: AL705_02095Help
Entry
AL705_02095       CDS       T04080                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
cbq  Lawsonella clevelandensis
Pathway
cbq00450  Selenocompound metabolism
cbq00970  Aminoacyl-tRNA biosynthesis
cbq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AL705_02095
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AL705_02095
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cbq01007]
    AL705_02095
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cbq03016]
    AL705_02095
Enzymes [BR:cbq01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     AL705_02095
Amino acid related enzymes [BR:cbq01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   AL705_02095
Transfer RNA biogenesis [BR:cbq03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    AL705_02095
 Prokaryotic type
   Other AARSs
    AL705_02095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: ALE18676
UniProt: A0A0M4M7S7
Position
complement(480084..481940)
Genome map
AA seq 618 aa AA seqDB search
MTTPVLTAVAWPYANGPRHIGHVSGFGVPSDVFSRYQRMVGNDVLMVSGTDEHGTPLLVQ
ADKEGMNVHDLADRYNRVIVNDLAGLGLSYDLFTRTTTRNHYAVVQEMFRNVAKNGYLVT
KKTTGAISPSTGRTLPDRYIEGTCPICGYDGARGDQCDNCGNQLDPADLINPVSKINGET
PKFVETEHWFLDLPALADTLGDWLRERKDWRPNVLKFSLNLLDDIKPRAMSRDIDWGIPI
PIEGWQERNDKRLYVWFDAVVGYLSASIEWAYRIGDPDAWRKWWNNPEALSYYFMGKDNI
TFHSQIWPAELLAYNGQGSKGGDRGMLGELNLPTEVVSSEYLTMSGSKFSSSRGVVIYVK
DFLKEFGPDALRYFIAVAGPENQDTDFTWDEYVRRTNSELANEWGNLVNRTVSMAYKNFG
QIPTPGTLTEADMELHRRADEAFQVVGANLARSHFKAGITEAMRYVADANRYIAAQEPWK
IAKEVKAGGAAAPEAEDRLATVLHTALQAVQDANTLMTPFIPNASQKIFEQLGGDGVWAA
QPVIHEVVDDMPVAPVGAGVPAAGREYPVIMGDYASELASWERHDITPGTPLSKPQPIFH
KLDPELGETGPEWAPVQH
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atgactacgcctgttcttaccgctgttgcctggccgtacgccaacggaccgcgccatatt
ggtcacgtttccggattcggcgtcccctcagacgtcttttcccgctaccagcgcatggtc
ggaaacgatgtgttgatggtctccggcaccgacgaacacggcaccccgctgctggtgcag
gcggataaagagggcatgaacgtccacgaccttgccgaccgctacaaccgcgtcatcgtt
aacgacctggccggtttggggctctcctacgacctgtttacgcggaccacaacccgaaac
cactacgccgtcgtacaggagatgttccgcaacgtggcgaagaacggctacttggtgacg
aagaaaaccaccggcgcaattagcccctccaccgggcgtactctgcccgaccgctacatt
gagggcacctgccccatttgcggttacgacggggcccgcggcgaccagtgtgacaactgc
ggtaatcagctcgacccggcagacctcattaacccggtgtcgaagatcaatggtgagact
ccgaagttcgtggaaacggagcattggttcctcgaccttcccgcacttgccgacacgctg
ggggattggctgcgtgaacgcaaagactggcgtcccaatgtgttaaagttctccctcaat
ctgcttgatgacatcaaaccgcgggccatgagccgcgacatcgactggggtattcccatc
cctatcgaggggtggcaggaacgcaacgataagcgcctctatgtgtggttcgacgccgtg
gtgggttatctgtctgcctccatcgaatgggcctaccggattggggacccggatgcttgg
cgcaagtggtggaataacccggaggcgctcagctactacttcatggggaaagacaacatc
accttccatagccaaatttggccagctgagctactcgcctacaacgggcagggtagcaag
ggtggcgaccgcgggatgctgggtgagcttaatctccccaccgaggttgtctcctctgag
tacctgacgatgtctggatcgaagttctcctcgtcacgcggcgtggtgatctacgtcaag
gacttcctcaaggaattcggcccggatgctttgcgctacttcattgcagtggccggcccc
gaaaaccaggacaccgacttcacgtgggatgagtatgtgcgtcgtaccaatagcgagctt
gctaacgagtggggaaatttggtgaaccgtacggtctccatggcgtataagaactttggg
cagatccccaccccgggcacgctgactgaggcggatatggagctacacaggcgtgctgac
gaggcattccaggtggtgggcgccaatctggcacgctcccacttcaaggctggtatcacg
gaagcgatgcgctatgttgcagatgctaaccgttacattgcggcacaggaaccgtggaag
attgctaaagaagtgaaggctggaggggcggctgccccggaagcggaggaccgtctcgct
actgttctccatacggctctacaagcagtgcaggatgccaatacgctcatgacccccttc
ataccgaatgcttcgcagaagatctttgagcagctgggtggtgacggcgtgtgggctgcc
cagccggttattcatgaggttgtggacgacatgccagtggcaccggtgggtgccggtgta
cctgcagcgggccgcgaatacccggtcattatgggcgactacgccagcgaactggcgtcc
tgggaacgccatgacattacccctggtacgccgttgtccaagccgcagccgatcttccac
aagcttgatccggaattgggcgagacaggcccggagtgggccccagtccagcactag

DBGET integrated database retrieval system