KEGG   Caenorhabditis briggsae: CBG01744Help
Entry
CBG01744          CDS       T01054                                 

Gene name
Cbr-cyc-2.1
Definition
(RefSeq) C. briggsae CBR-CYC-2.1 protein
  KO
K08738  cytochrome c
Organism
cbr  Caenorhabditis briggsae
Pathway
cbr04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Cellular Processes
  Cell growth and death
   04215 Apoptosis - multiple species
    CBG01744 (Cbr-cyc-2.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 DUF3365 Cytochrome-c551
Motif
Other DBs
NCBI-GeneID: 8576171
NCBI-ProteinID: XP_002634176
WormBase: CBG01744
UniProt: A8WQY3
Position
IV
AA seq 112 aa AA seqDB search
MADIPAGDYEKGKKVYKQRCLQCHVVDSTATKTGPTLYGVIGRTSGTVAGFDYSAANKSK
GVVWTRETLFEYLLNPKKYIPGTKMVFAGLKKADERADLIKYIEVECSKPLA
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atggccgatatcccagctggagattacgaaaagggaaagaaggtgtacaagcagagatgc
ttgcaatgccacgtcgttgattccaccgccacaaagaccggaccaaccctttacggagtc
atcggacgtacctctggaacagtcgctggattcgactattctgctgctaacaagagcaag
ggagtcgtctggactcgtgaaaccctcttcgagtaccttctcaacccaaagaagtacatc
ccaggaaccaagatggtgttcgctggactcaagaaggctgatgaacgtgctgatcttatc
aagtacatcgaggtggaatgctccaagccactcgcctaa

DBGET integrated database retrieval system