KEGG   Caenorhabditis briggsae: CBG02116Help
Entry
CBG02116          CDS       T01054                                 

Definition
(RefSeq) Hypothetical protein CBG02116
  KO
K18932  palmitoyltransferase [EC:2.3.1.225]
Organism
cbr  Caenorhabditis briggsae
Brite
KEGG Orthology (KO) [BR:cbr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CBG02116
Enzymes [BR:cbr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     CBG02116
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC
Motif
Other DBs
NCBI-GeneID: 8585871
NCBI-ProteinID: XP_002643878
WormBase: CBG02116
UniProt: A8WS09
Position
X
AA seq 307 aa AA seqDB search
MNKFCDFIDDRIDDGTFTPMVNAANSSMRQIGKFLVFFVYFISALLAFTSFFIIIPYEQL
YKPGWLLITLGVFGIYFLINIQYHYYKARTIAPVANPGEEGDEFCDKCNYWKSDRTHHCS
VCERCIYGMDHHCIWINQCVGSHNHRHFFLFVANLTLAASVIIFAGFQSFYDHLFMEYSQ
YTFCTTILEHAPLQDIICEYDGFARTAVVFSYLLSGILLVMVGGLTFWNFYLISIGCTYI
DYLKRSGNKKKQQTLRNRLNKGFKSNWKNFLGLRRNRTFFRCVIIPTTFPPVIFENINTR
YDNFDIV
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagttctgcgacttcatcgatgataggattgacgatgggacgtttactccaatg
gtcaatgcggccaactcgtcaatgcggcagattggtaaattcctcgtcttcttcgtctac
ttcatctcagcacttcttgccttcacctcatttttcattattatcccatatgaacagtta
tacaaaccaggatggctactcatcactctaggtgtctttggaatatattttctgatcaat
attcaatatcattactacaaggctagaacgatagcacccgttgctaatcctggggaagaa
ggtgatgaattttgcgacaaatgcaactactggaaaagcgacagaacacatcattgctca
gtgtgcgagcggtgtatatatggcatggaccatcattgcatttggattaatcagtgtgtt
ggatcacacaatcatcgccatttcttcctctttgtagcaaatttgacactagctgccagt
gttatcatttttgcgggtttccagtcattctatgatcatttgtttatggagtactcacaa
tacacattttgcacaacaattctggagcacgcacctcttcaagacattatttgtgaatac
gatggatttgcgagaactgcagttgtcttttcttatctcctcagtggcatcttattggtt
atggttggcggccttactttttggaacttctacttgatatccattgggtgcacatatatt
gattatttgaaacgaagcggaaacaaaaaaaagcagcaaaccctgagaaatcggctcaac
aaaggcttcaaatccaactggaagaactttttggggcttcgacggaatcgaacatttttc
cgatgtgttataataccaactacattcccgccggtgatatttgagaatattaatacgcga
tacgataactttgatattgtatga

DBGET integrated database retrieval system