KEGG   Caenorhabditis briggsae: CBG03956Help
Entry
CBG03956          CDS       T01054                                 

Gene name
Cbr-rpa-2
Definition
(RefSeq) C. briggsae CBR-RPA-2 protein
  KO
K10739  replication factor A2
Organism
cbr  Caenorhabditis briggsae
Pathway
cbr03030  DNA replication
cbr03420  Nucleotide excision repair
cbr03430  Mismatch repair
cbr03440  Homologous recombination
cbr03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    CBG03956 (Cbr-rpa-2)
   03420 Nucleotide excision repair
    CBG03956 (Cbr-rpa-2)
   03430 Mismatch repair
    CBG03956 (Cbr-rpa-2)
   03440 Homologous recombination
    CBG03956 (Cbr-rpa-2)
   03460 Fanconi anemia pathway
    CBG03956 (Cbr-rpa-2)
DNA replication proteins [BR:cbr03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    CBG03956 (Cbr-rpa-2)
DNA repair and recombination proteins [BR:cbr03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     CBG03956 (Cbr-rpa-2)
   MMR (mismatch exicision repair)
     CBG03956 (Cbr-rpa-2)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     CBG03956 (Cbr-rpa-2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPA_C tRNA_anti-codon Ten1_2
Motif
Other DBs
NCBI-GeneID: 8581365
NCBI-ProteinID: XP_002639372
WormBase: CBG03956
UniProt: A8WVU6
Position
I
AA seq 286 aa AA seqDB search
MWNETADHEHGAGGWAGGESSFMTDRKPDSKAATLGDRLPVPVTISNLNEHFSATDDKYI
IGNFRFATVQTVGIVKEINQEGTTWSYDLCDPNNEAMEYRALKYENEGSNSDQSSIVEGT
RVRAIGKLKSFDGSNSIMLFNITPVTDDKDFTIFELEAEAARLFFQKNMNDKLKSDASSR
GFQGMLAPPKSRAGQQPMQQSSQGSDKKERLYPAQSQVNVEGDLRQRVTAVLKGVSEEAH
EEGSNILWIAEQLQEKDIKKLRDCLSGMVENGLAYTTTDEETFSVI
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgtggaacgaaactgccgatcacgaacacggtgccggaggatgggctggaggagagtct
tccttcatgaccgacagaaaaccagattcgaaagccgccacacttggagacagacttccg
gttccagttaccatctctaacctcaacgagcacttttctgccactgatgacaagtacata
attggaaactttcgtttcgctactgtccaaaccgtcggaattgtgaaggagataaaccaa
gagggaacaacctggagctacgatctttgtgatccaaacaacgaggccatggagtaccgt
gcgctgaaatacgagaacgaaggatcgaactccgatcagtcttcaattgtggagggaact
cgtgtccgtgctatcggaaagctgaagagtttcgatgggagcaactccatcatgcttttc
aacatcactcctgtcacggacgacaaagattttaccatcttcgagctcgaagccgaagca
gctcgtctctttttccaaaagaacatgaatgataagctcaaatcggatgcttcttctaga
ggattccaaggaatgttggccccgccaaagagcagagctggacaacagccgatgcagcaa
agctcgcaaggatctgacaaaaaagagagattgtatccagctcagtctcaagttaatgtt
gaaggagaccttagacaacgtgtcactgccgttctgaagggcgtctctgaagaggctcac
gaagagggatcaaacattctctggattgctgaacaacttcaagagaaagacatcaagaag
ttgcgcgactgtctctctggaatggtcgaaaatggactggcctacactactactgatgaa
gaaaccttctccgtcatctaa

DBGET integrated database retrieval system