KEGG   Caenorhabditis briggsae: CBG05896Help
Entry
CBG05896          CDS       T01054                                 

Gene name
Cbr-plc-4
Definition
(RefSeq) C. briggsae CBR-PLC-4 protein
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
cbr  Caenorhabditis briggsae
Pathway
cbr00562  Inositol phosphate metabolism
cbr01100  Metabolic pathways
cbr04020  Calcium signaling pathway
cbr04070  Phosphatidylinositol signaling system
cbr04933  AGE-RAGE signaling pathway in diabetic complications
Module
cbr_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    CBG05896 (Cbr-plc-4)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    CBG05896 (Cbr-plc-4)
   04070 Phosphatidylinositol signaling system
    CBG05896 (Cbr-plc-4)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    CBG05896 (Cbr-plc-4)
Enzymes [BR:cbr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     CBG05896 (Cbr-plc-4)
Membrane trafficking [BR:cbr04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    CBG05896 (Cbr-plc-4)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    CBG05896 (Cbr-plc-4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y C2 EF-hand_10 EF-hand_like EF-hand_8 EF-hand_6 EF-hand_5 EF-hand_1 EF-hand_7 PH GDPD
Motif
Other DBs
NCBI-GeneID: 8575180
NCBI-ProteinID: XP_002633183
WormBase: CBG05896
UniProt: A8X1E0
Position
IV
AA seq 752 aa AA seqDB search
MANKNVSPEEQAAAQAADEEKTKEELEWAEKGSLLCRIKNQKVKEMSLVTIKSKQFLNYY
SSYWFNFVPNALKSVALSELLEVRSGYQTDNLQRASKKYEFQELAPESRCFSVIFSHAKF
LHKSVDFCADSKETRDKWVSVLTHLISVAKHQRVVFNETAWLIDKFQQADTNKNGLLSFD
EVWNLLKRMNLQISERYAKAIFRESELEDSRDNKLNEKEFLNFFERLTDRPDLRFVMTQA
SSDNVETLTVADLQRFLTEEQGFEKVDLKKAEQILDTFEQTVQDKQKEKLMGLMGMRRLM
QSRWGNVFKPGHESIFQDMDQPLTHYFVNSSHNTYLTGLQVKGEATVEGYISALRKGARL
LELDLFDGEHGEPVITHKRTFIESITLRNSLEAIKRTAFETSPYPVILTLENHVGFVQQT
VMAELFKEILGDSLYIPPKDSHRHPLPSPNKLKRKFLLRGKKIILEEDIEEPDEDDSPTD
KDKHHVHPHPVSPELSALIGLPSVKLSHNIYQDVHKHPFDGSPSLSENKVYTMFEAAVPI
FTYTAERLVKSYPKGLRQDSSNMHPIVSWLCGIQSVAMNFQTAGEELDLNAGLFRSNGNC
GYVLKPGCLLDGVDPRSMSKPKMKLGIGLFSAQYLPKSEPGKEIIDPYVSVQIFGIPRDE
TKAKTRIIKDNGFNPEWRDNFYFTLCCPELAILRFCVKDFDSTSSNDFVGEFSIPVMSLR
TGYSQIQLNTGYQHTLDPSASLFVRIAIEEEY
NT seq 2259 nt NT seq  +upstreamnt  +downstreamnt
atggccaacaagaacgtctctccagaagagcaggctgctgcacaagctgcagatgaagaa
aaaaccaaagaagaattagaatgggccgagaaaggatcattattatgcaggattaaaaat
caaaaagtgaaggagatgtctttagtgactatcaaaagcaaacaattcctcaactactat
tcaagttactggttcaattttgttccgaatgcactgaaatccgttgcgttgtctgaacta
ctcgaagttcgatctggctatcaaaccgataatttgcaaagagcgtcgaaaaagtacgaa
tttcaagagttggcaccagaatcaagatgcttctctgttatcttttcccatgctaaattc
ctacacaagtcggttgatttttgtgccgattccaaagaaacgcgcgacaaatgggtttcc
gtactaactcatctcatatcagttgccaaacatcaacgagtcgtcttcaacgaaactgct
tggctgattgacaaattccagcaagcagacaccaacaaaaatggtcttctttcattcgat
gaagtttggaatcttctcaaaagaatgaatcttcaaatcagtgaaagatatgcaaaagca
atcttcagggagtcagaattggaagattcaagggataacaaattgaatgaaaaagaattt
ctcaattttttcgaacgactgacagaccgtccagatcttcgttttgtgatgacgcaagct
agttctgataatgtggaaacgttaactgtcgcagatttgcaaaggtttctaacagaagaa
caaggttttgaaaaagttgatctgaagaaagccgagcaaatccttgataccttcgaacaa
accgtgcaagacaaacaaaaggaaaagttgatgggtctgatgggaatgcggagattgatg
caatccagatggggaaatgtattcaagccagggcatgaaagtatcttccaagatatggat
caaccactcacccactactttgtcaattcatcacataacacatatttgacggggttgcaa
gtgaaaggagaagcgacagtggaaggctacatttctgcgttgaggaagggagcaagacta
ctggagttagatttgtttgatggtgagcatggagagccagtcatcactcataaaaggaca
ttcattgagtcaatcacactgagaaactcattagaagctatcaagagaacagccttcgaa
acatctccgtatcctgtgatcttgactctcgaaaaccacgttggattcgtgcagcaaaca
gtaatggcggaattgttcaaagaaattcttggagattctctatacattccacccaaagat
tcacatcgtcatccattgccatcaccaaacaaactcaaacgaaaattccttttgcgcgga
aagaaaatcattttggaagaagatattgaggaaccggatgaggacgactcaccaactgat
aaggacaagcatcatgtccatcctcatccagtttctcctgaactctcggctctaattgga
ttgccatctgtgaaattgagtcataacatctatcaagatgttcacaaacacccattcgat
ggaagtccttctctgtccgagaacaaagtttacaccatgttcgaggctgctgtcccaata
ttcacatacactgcagaacggctggtgaagagttatccaaaaggcttgcgtcaagattct
tccaatatgcatccgatcgtttcgtggttgtgtggaattcaaagtgttgctatgaacttt
caaactgctggagaagaattagatctgaatgcaggattgttcagaagcaatggtaattgt
ggttatgttttaaaaccagggtgtttgctggatggagttgatccaagaagtatgtcaaaa
ccaaagatgaagcttggcattggtcttttctcggcgcaatatcttccaaaatcagagcct
ggaaaggagatcattgatccatatgttagtgttcaaatctttggaattccacgtgacgaa
acaaaggcaaagaccagaatcatcaaggataatggattcaatccagaatggagagacaat
ttctattttacgctctgttgcccagagcttgccattcttcgattctgcgtgaaagacttc
gattctacttcatccaacgatttcgtcggggagttttcaattccagtgatgagtcttcgc
accggttattcccagattcagttgaacactggatatcaacacactttggatccatctgca
tccctttttgtcagaattgcaatcgaggaggaatattga

DBGET integrated database retrieval system