KEGG   Caenorhabditis briggsae: CBG06108Help
Entry
CBG06108          CDS       T01054                                 

Gene name
Cbr-mrs-1
Definition
(RefSeq) C. briggsae CBR-MRS-1 protein
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
cbr  Caenorhabditis briggsae
Pathway
cbr00450  Selenocompound metabolism
cbr00970  Aminoacyl-tRNA biosynthesis
cbr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CBG06108 (Cbr-mrs-1)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CBG06108 (Cbr-mrs-1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cbr01007]
    CBG06108 (Cbr-mrs-1)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cbr03016]
    CBG06108 (Cbr-mrs-1)
Enzymes [BR:cbr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CBG06108 (Cbr-mrs-1)
Amino acid related enzymes [BR:cbr01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CBG06108 (Cbr-mrs-1)
Transfer RNA biogenesis [BR:cbr03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CBG06108 (Cbr-mrs-1)
 Prokaryotic type
   Other AARSs
    CBG06108 (Cbr-mrs-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind Anticodon_1 tRNA-synt_1 CBP_BcsO tRNA-synt_1e zinc-ribbons_6
Motif
Other DBs
NCBI-GeneID: 8575361
NCBI-ProteinID: XP_002633364
WormBase: CBG06108
UniProt: A8X0V9
Position
IV
AA seq 921 aa AA seqDB search
MGVDLNEIKKNFNVNTSAYVEKKDPKSILPQPGKRNILITAALPYVNNVPHLGNIIGCVL
SADVFARYCNLRGHQTFYVGGTDEYGTATETKALQEGCTPRELCDKYHAIHKGIYEWFGI
DFTHFGRTTTDHQTEICQDMFLKLHKNGFTTTQTVDQLFCNQCDKFLADRFVTGTCPNCA
YDDARGDQCDGCGKLINAVELKDAKCHMCKSTPEVKQSTHIFLSLDKLQESTMDLIMKQM
DLPGSKWSANAKGITKSWENQGLEPRCITRDLKWGTPVPLEGFEKKVFYVWFDAPIGYLS
ITKCVLGDDWTKWWKNPSNVELYNFVGKDNVAFHGVMFPCSQVGANDNYTVVNHLCATEY
LNYEDTKFSKSRGTGIFGDAAQRTGIPADIWRFYLLYMRPESQDTAFSWDDFVLKVNSEL
LNNLGNFINRALSFVANFFGGVIPNMDLTEADATILEEIHQECLQWDTQFDGVRLKDAVK
SILNVSRIGNQYMQSQTPWVLMKGDDAAKKRAGTIIGVAANIAYHLAVILYPVMPSVSET
IRQQCDLSKLPLFSPFPRNYLKPGHKIGKPSPLFQKLDPIQIAEFKAKFGGGQNPQNAAV
AAAAGNQKQQKKTPPTKEKKGGDKKKMASTAAFAELEQGAKLISQLLTTNLKKFEQAKAL
FARNKLQKLEEENRQLTLDAKSLQQQLVELEKAAGIKQIPKPVASCTPTPTSTPASGIIN
QQKNATPAPQPTAEPKKAKEQKKGKGGGAAAAAPVDDAIDIGRLDMRVGRIIKCEKHPDA
DALYVEQIDVGEESPRTVVSGLVRHVPLDQMQNRLVVVLCNLKPAKMRGVESRAMVMCAS
TPDKVEIMEVAADSKPGTPVVCPPLTHRPDEQLNPKKKIWETVAEDLKVSAEGFAEWKGH
PLLVGNATKMTAPTLRGCHVK
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtcgacctcaatgagataaaaaaaaacttcaatgtgaacacttctgcttatgtg
gaaaagaaggacccaaaaagtatcttgccacagcctggaaaacgaaacattttgatcact
gctgctcttccttatgtgaataacgttccacatcttggaaacatcatcggatgcgttcta
agcgctgacgttttcgcgagatactgcaatctccgtgggcatcaaaccttctacgttggc
ggaaccgatgagtatggtactgctacggaaacgaaagcacttcaagaaggatgcacgccg
cgcgagttgtgtgataaatatcatgcaattcacaaaggaatctacgaatggttcgggatt
gactttactcacttcggaagaaccaccactgatcatcagaccgagatctgtcaagacatg
ttcttgaagcttcacaagaatggtttcaccacaacacaaacggtggatcagctgttttgc
aatcaatgtgataaattcctcgccgatagatttgtcactggtacctgtccgaactgtgcg
tacgatgacgcacgcggagatcagtgtgatggatgcgggaaacttatcaatgccgttgaa
ttgaaggatgcaaagtgtcatatgtgcaaaagcacaccagaagtgaaacagtccactcac
attttcctttctttggataaacttcaagaatctacaatggatttgatcatgaaacaaatg
gatctaccgggttctaagtggtccgctaatgccaagggaatcacaaagtcttgggagaat
caaggattagaaccacgatgtattacgcgagacctgaaatggggaacacctgttccattg
gaaggattcgagaagaaagtgttttatgtgtggttcgatgctccgattggctacctatcc
atcacaaaatgtgttcttggagatgactggaccaagtggtggaaaaatccgagcaatgtc
gagctctacaatttcgttggaaaggataacgtcgcattccacggcgttatgttcccatgc
tcgcaagttggagcaaacgacaactacactgttgtgaaccacctctgtgctactgaatat
ctaaactatgaagacaccaaattcagcaagtctcgtggaaccggaatcttcggagatgct
gctcaaagaacaggaattccagctgatatctggcggttttatttgctgtacatgagacca
gaaagtcaggatactgccttcagttgggacgattttgtgctgaaagtcaacagcgaactg
ctcaacaatcttggaaacttcatcaaccgcgctctctcattcgtggctaactttttcgga
ggagttattccaaacatggatttaacggaagcggatgctacgatccttgaagaaattcat
caagaatgtctgcagtgggatactcagtttgacggagttcgtcttaaggacgctgtcaaa
agtattctgaacgtttctcggattggaaaccagtatatgcaatctcaaactccatgggtt
ctcatgaaaggtgatgatgcagcgaagaagcgtgcgggtacgatcattggagtagctgcc
aacattgcctatcatctggctgttatcctctatccagtcatgccgtctgtttcggaaacc
atccgtcagcagtgtgacttgtcgaagcttccactttttagcccattcccaagaaactac
ctcaagccaggacacaaaatcggaaagccttctccgcttttccaaaaattggatcctatc
caaatcgcagaattcaaggcgaaatttggcggtggtcaaaatcctcagaatgctgcagtt
gcagcagctgctggaaatcagaagcaacagaagaaaactccacctaccaaggagaaaaaa
ggcggcgacaagaaaaaaatggcctcgactgctgctttcgcggaacttgaacaaggagcg
aaactcatctcgcaacttctcaccacgaacttgaagaaattcgagcaagctaaagcccta
ttcgctcgcaataaacttcaaaagttggaggaggaaaatagacaactcacccttgatgcc
aagtcccttcaacagcaattggtcgaattagaaaaagctgctggaattaagcagattccc
aagccagttgcatcatgcactccaacacctacttcaactccagcgtctggtatcattaac
cagcagaaaaatgccacaccagctccacaacctactgctgaaccgaaaaaagcaaaagaa
cagaaaaagggtaaaggaggtggcgcagccgctgctgctccagttgacgatgctattgat
attggaagacttgacatgcgagttggcagaatcatcaaatgcgagaaacatccagatgct
gatgctctatatgttgaacagattgatgttggtgaggaatccccgagaactgtcgtctct
ggtcttgttcgtcacgtacctctcgatcaaatgcagaatcgtcttgtggtcgttctgtgc
aatttgaagccagcgaaaatgcgtggagttgaatcgagagctatggtcatgtgtgcttcg
actcctgacaaagtggaaattatggaagtggctgctgacagtaaaccaggaactcctgtt
gtttgtccaccgttgactcaccggccagatgagcaattgaatccaaagaagaagatctgg
gaaactgttgccgaagacttgaaagtgtctgctgagggattcgcagagtggaagggacat
ccgcttcttgtcggaaacgcgaccaagatgacagctccaacccttcgtggatgtcatgtt
aaataa

DBGET integrated database retrieval system