KEGG   Caenorhabditis briggsae: CBG07732Help
Entry
CBG07732          CDS       T01054                                 

Gene name
Cbr-ent-2
Definition
(RefSeq) C. briggsae CBR-ENT-2 protein
  KO
K15014  solute carrier family 29 (equilibrative nucleoside transporter), member 1/2/3
Organism
cbr  Caenorhabditis briggsae
Brite
KEGG Orthology (KO) [BR:cbr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cbr02000]
    CBG07732 (Cbr-ent-2)
Transporters [BR:cbr02000]
 Solute carrier family (SLC)
  SLC29: Facilitative nucleoside transporter
   CBG07732 (Cbr-ent-2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nucleoside_tran RSN1_TM EVC2_like Ste5
Motif
Other DBs
NCBI-GeneID: 8587955
NCBI-ProteinID: XP_002645956
WormBase: CBG07732
UniProt: A8X474
Position
X
AA seq 450 aa AA seqDB search
MSSGTELQPLNEPKNVEETAVEVEEEAPEDRKNLVFFIILLHGIGTLMPWNMLITISYDY
FESYKMLANSTIDMDTGAVTGDPTVYSSNFQSFQTIASQVPNLLLNLLNIFIVVKGGLAG
RITVGLSIVAVCVITTMAFIYVETHTWLTGFFILTIATIIILNGANGVYQNSIFGLAGEL
PFKYTNAVIIGNNLCGTFVTLLSMSTKAVTRNILDRAFAYFLIALITLVFCFISFLILKK
QRFYQFYSTRAERQRAKNEESADNKGKMATYVATFKEAFPMLLNVFLVFFVTLSVFPGVM
MYVKDEKKGGTYDFPLPKNYFMDVTTFLQFNVFAFIGSIVAGRKQWPAPNKLWIPVYLRL
LYIPFFAFCNYLPETRTWPVLFESTWLFVIVAASMSFGSGYFSGLAMMYTSKTVDPSRAQ
VAGMMAGFSLISGIVSGLLFTMVIKMFVTA
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcaggcacggaacttcagccgctcaacgagccaaaaaatgtggaggagaccgca
gtggaggtcgaggaagaggctccagaagatagaaagaatcttgtcttcttcatcatcttg
cttcacggaatcggaactctcatgccatggaatatgctcatcacgatttcatatgattac
ttcgaatcatacaaaatgctcgccaactcgaccatcgacatggacactggagccgtgacc
ggagacccgactgtctattcatctaacttccagagtttccaaacgatcgcctcccaagtg
ccgaaccttcttcttaatcttctcaacatcttcattgtcgtcaaaggaggactcgctgga
cgtatcaccgttggactttccatcgtcgctgtctgcgttatcaccaccatggccttcatc
tacgttgagacacatacctggctcaccggcttcttcatcctcaccattgccactatcatc
atcctcaacggtgccaatggagtctaccagaacagtatcttcggtctcgccggcgaactt
ccattcaagtacaccaatgctgtcatcattggtaacaatttgtgcggaacgtttgttacc
ttgctcagcatgtccaccaaggctgtgacccgcaacatcttggaccgtgcctttgcctat
ttcctgattgctctcatcaccttggtcttctgcttcatctcgttcttgatcctcaagaaa
caacgcttctaccaattctacagtactcgtgccgagagacagcgtgccaagaatgaggaa
tccgcagataacaaaggaaagatggcgacctacgttgccacattcaaggaggccttccca
atgctcctcaacgttttcttggttttcttcgtcaccctttccgtgttcccaggagtcatg
atgtatgtcaaggatgagaagaagggcggaacctacgatttcccattgccaaagaactac
ttcatggacgtgaccactttccttcaattcaacgtcttcgccttcatcggatcgattgta
gccggaagaaaacaatggcctgccccaaacaagctctggatcccagtctacctccgcctc
ctctacatcccattcttcgccttctgcaactacctccctgagacccgtacctggccagtt
ctctttgagtccacctggttgttcgtcattgtcgctgcttcgatgagcttcggaagtgga
tacttctccggactcgccatgatgtatacctcgaagactgtcgacccatccagagctcag
gtcgccggaatgatggccggattctccctcatctctggcatcgtgtctggactgctcttc
accatggtcatcaagatgtttgtcactgcctaa

DBGET integrated database retrieval system