KEGG   Caenorhabditis briggsae: CBG07886Help
Entry
CBG07886          CDS       T01054                                 

Gene name
Cbr-cpt-1
Definition
(RefSeq) C. briggsae CBR-CPT-1 protein
  KO
K08765  carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21]
Organism
cbr  Caenorhabditis briggsae
Pathway
cbr00071  Fatty acid degradation
cbr01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cbr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CBG07886 (Cbr-cpt-1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cbr03029]
    CBG07886 (Cbr-cpt-1)
Enzymes [BR:cbr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     CBG07886 (Cbr-cpt-1)
Mitochondrial biogenesis [BR:cbr03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    CBG07886 (Cbr-cpt-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf
Motif
Other DBs
NCBI-GeneID: 8573909
NCBI-ProteinID: XP_002631909
WormBase: CBG07886
Position
II
AA seq 696 aa AA seqDB search
IFPFIQNYIVHYVFGDGYLGQSISIAVAGALLWLIFVQLLRLSIKTLLEYKGWMYESPGK
PVSKATKLWLGVLHIISKAGPMLHSFQGALPRLPLPKLDDTVRKHLLSMKPILNDEEYQE
LEFLSERFRKGVGRRLQRYLTLKSWFSSNYVTDWWEEFVYMRQRSPIMINSNYYGFDTLN
EHPTTNQASRAANLTYTSLQFRRMVDRQEVSPFSISPRTKVPFCTMQYERLFNTCRVPGE
KVDRLLHWDDAKHVAVYCRGVWFKLIVHNGKRLLEACELQHQYDTILAHSYEPSEGEMHL
ASLTAGERADWAKTRRAHFRSGVNKTSLNDIERAAFVVILDDEETHYDPEDPSKLDHWAH
NLLHGKAHDRWFDKSFNLIISKNGHVGINTEHSWGDAAVMAHFTEWSLLQDIVFIGYDAD
GRCKGEAKEKLTPERLKWDIPSPALEQIRKSMEVANALIADVEMSLLVWTDYGKGFAKKL
KVSPDAFLQMTLQYTYFKNQNKFSLTYEASMTRLFREGRTETVRSCTVQSSDFVRSMLDA
SKTPQERLQLLRKACDKHQELYRDAMCGQGVDRHLFALYVIKRYLEEESPFFDNIFPPTY
LLSTSQTPMNQCEADAKGLSNDVRLRLITAGGGFGPVADRGYGVSYIVAGENTLSFHISS
KRSADNTSSREFREELKRSLSDMKKLAEALEAPPKK
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atatttccgtttatccagaattatattgtgcattatgtctttggagacggctacctgggc
caaagcatctctatcgccgtcgctggcgctctcctctggctcatcttcgttcaacttctc
cgtctctcgatcaagacccttctggaatacaagggttggatgtacgagtcgcctggaaaa
ccagtgtcaaaagccacgaaactctggttgggcgtgcttcatatcatctccaaagccgga
ccaatgcttcactcgtttcaaggagccctgccacgtcttccactgccgaaattggatgac
actgttagaaagcacctcctctccatgaagccgatcctcaacgacgaagagtaccaagag
ctggaattcctctcggaacgcttccgaaagggagtcggacgacgtctccaacgctatctt
accctgaagtcgtggttctcctcgaactacgtcaccgattggtgggaggagttcgtctac
atgcgtcagcgatcgccaattatgatcaattccaactactacggattcgacaccctcaac
gagcatccaacaacgaatcaggcgtcgagagctgccaatctgacgtacacctctcttcaa
ttccggagaatggttgatcgtcaagaggtctcgccgttttccatctctccaaggactaag
gttccattctgtacgatgcaatacgagcggctattcaatacgtgtcgggtgcctggagaa
aaagtggatcgtcttcttcattgggatgatgccaagcacgtggctgtctactgtagaggt
gtctggttcaaactcatcgttcacaatggaaaacgtcttctggaggcttgtgaactccaa
catcaatatgatacgattctagcgcattcctatgagccatcagaaggagaaatgcatttg
gcttcgttgacagctggagagcgtgcggattgggccaagactcgcagggcacactttaga
agtggagttaacaagacgtctcttaacgatattgagcgagccgccttcgtggtgattctg
gacgacgaggagacccattacgacccggaagatccatcaaagttggaccactgggcgcat
aacttgctccatggaaaggctcacgatcgttggtttgataagtcattcaacctgattatt
tcaaagaatggacatgttggaatcaatacggaacactcttggggcgacgctgcggtgatg
gcacactttacggaatggtccttgcttcaggatattgtattcattggatatgacgctgat
ggacggtgcaaaggagaggccaaggagaaactgaccccggaaagactcaaatgggacatt
cccagccctgctctagaacagattcgaaaatcgatggaggtggcgaacgcgttgattgct
gatgttgagatgtcgctgttggtttggacggattacggtaaaggatttgccaagaagttg
aaggtgtcgccggatgcgttccttcagatgacgttgcagtatacttattttaagaaccaa
aacaaattctcgctaacctacgaagcctcgatgacccgcctcttccgtgaaggacgtact
gaaaccgttcgctcctgcaccgtccaatcctccgacttcgttcgctccatgctcgacgcc
tccaagaccccccaggaacgtcttcaactcctccgcaaagcctgtgacaagcatcaagag
ctctatcgtgacgccatgtgtggccagggagtcgatcgtcacctcttcgctctgtacgtc
atcaagagatacctcgaggaggagtctccattcttcgacaacattttcccgccgacctat
ctgctctcgacgtcccaaaccccgatgaatcagtgtgaagccgatgccaaggggctttca
aatgacgttcgtttgagattgatcaccgctggaggtggattcggacctgtagccgataga
ggatacggtgtgtcgtatattgtcgctggtgaaaacacgctgtcgttccatatctccagt
aagcgatcagcggataacacgagctcccgcgagttccgtgaagagctgaaacgctcgctt
tccgacatgaagaagttggccgaagcgctggaagcaccaccgaagaag

DBGET integrated database retrieval system