KEGG   Caenorhabditis briggsae: CBG07947Help
Entry
CBG07947          CDS       T01054                                 

Definition
(RefSeq) Hypothetical protein CBG07947
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
cbr  Caenorhabditis briggsae
Pathway
cbr00071  Fatty acid degradation
cbr00410  beta-Alanine metabolism
cbr00592  alpha-Linolenic acid metabolism
cbr00640  Propanoate metabolism
cbr01040  Biosynthesis of unsaturated fatty acids
cbr01100  Metabolic pathways
cbr01212  Fatty acid metabolism
cbr04146  Peroxisome
Module
cbr_M00087  beta-Oxidation
cbr_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:cbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CBG07947
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CBG07947
   00592 alpha-Linolenic acid metabolism
    CBG07947
   01040 Biosynthesis of unsaturated fatty acids
    CBG07947
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CBG07947
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    CBG07947
Enzymes [BR:cbr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     CBG07947
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_ox_N Acyl-CoA_dh_M DUF1833
Motif
Other DBs
NCBI-GeneID: 8588134
NCBI-ProteinID: XP_002646081
WormBase: CBG07947
Position
I
AA seq 661 aa AA seqDB search
LNKSIEPGDNPDLTEERASGTFDTNAMAAVIYGSDKFAQRRREISEAISKIPELADSAPL
PFLDRFGKVTEGSRKLSVILENIDKLIDPSSYEEGLHLYTEVMGMEGHPLALHEVMFIPA
LIAQASDEQQVKWLGRARRREIIGCYAQTEMGHGSNLRALETTATYSPETQEFILHSPTI
TSLKWWPGALGKSANWAVVVANLTIRDKNYGPHPFMVQLRDEDSHEPLPGITVGDIGSKM
AFNGGDNGFLGFRNYRIPREYLLNRHAKVEADGRYVKPPHAKINHSAMIRVRSHMATGQG
ALLAHALVIAVRYSAVRRQGYLEDKSREVKVLDYQTQQHRLFPSIARAYAFIFCGFETIR
LYDQLLIDVQNGNTSGMADLHALTSGLKSVVTYQTGEGIEQARMACGGHGYSMASYISEI
YGVAIAGCTYEGENMVMLLQLARYLVKSIEMIQNGKSRELGPMVAYLAEKESEIDLNLRP
NEYLKVFEYAARNQTWRATEKYQKLIEKGESKDVAWNNCAVEMTRASRLHTRLYIMSTFI
NHVGSIVDQKVKGVLIDLLNVHVTYEVMDIGIYVQGLLSSNQMDLIRNQLYVSLETIRPN
AVSLVDSFQISDMQLRSVLGRRDGNVYENLFKWAKSSPLNKTDVLPSVTQYLKPMMDKSK
L
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
ttaaacaagtcaattgaacctggagacaatccggatctcaccgaggagagagcttctgga
acatttgatacaaatgcaatggctgcggtgatttatggaagtgacaagttcgcccaacgc
cgtcgagaaatctctgaagcaatttcgaaaatccctgaactcgctgattcggcacctctc
cctttcctagatcgttttgggaaagtaacagaaggatctagaaagctatcagtgattctg
gagaatattgataagctgattgatccgagtagctatgaagaaggtcttcatctttataca
gaggttatgggtatggaagggcatccattggcacttcacgaagtcatgttcattccagca
cttattgctcaggctagcgatgagcaacaggtgaaatggttgggaagagctagacggaga
gagattatagggtgctatgcgcagacggaaatgggacatggatcaaacctccgagccctg
gaaaccacagctacatactccccagaaacccaagaattcattctacattctccaacaata
acttccttgaaatggtggcctggagcacttggaaaaagtgcaaattgggcagttgtggtg
gccaatctaaccattcgtgataagaactatggaccacatccattcatggtccagttgaga
gatgaagactctcatgaaccacttccagggattactgtaggagatatcggctccaaaatg
gcgtttaatggaggagacaatgggtttttgggattcagaaactaccgtattccacgtgaa
tatcttctgaatcgccatgcaaaagtggaggcagacgggagatatgtgaaaccaccacat
gcaaagatcaatcattcagcaatgattcgggttaggagtcacatggcgacagggcaggga
gcactgttggctcatgcattggtgatagcagtgagatattcggcagtgaggagacaaggg
tacttggaggacaaaagccgtgaagtgaaagtgctggattaccaaacccaacaacaccgt
ctattcccatcaatcgctcgcgcctacgccttcatcttctgtggatttgaaacaattcga
ttatatgatcaattattgattgatgttcaaaatgggaatacatctggaatggctgatcta
catgcattgacttctggattgaaatcagtggtcacttatcagactggagagggcattgaa
caggcgagaatggcatgtggagggcatggttattctatggccagctacatctctgagatc
tatggagtcgcaatcgccggatgtacgtatgaaggggagaatatggtgatgcttctccag
ttggcaagatatcttgtcaaatcgattgaaatgattcaaaatggaaaatcaagggaattg
ggaccaatggtggcgtatctagctgaaaaggaatcagaaattgatctaaatttgagacca
aatgagtatctgaaagtgttcgaatatgcagcaaggaatcagacatggagagctacggaa
aagtatcaaaaattgattgaaaagggagaatccaaagatgtagcctggaataattgtgct
gtagagatgactagggccagtcgcctgcacactcgtctctacataatgtccactttcatc
aatcatgtaggatcaatagtagatcaaaaagtgaagggcgtattgattgatttattgaat
gtacatgtaacatatgaagtcatggacattggaatatatgtccagggattactgtcatcg
aatcaaatggacttgataaggaatcagttgtatgtgtctcttgagacaatccgtcccaac
gctgtctctctcgtcgactcattccaaatcagtgatatgcagttgagatcggtcctcggt
cgtcgcgatggaaatgtctatgagaatctcttcaaatgggcaaaatcgtctccattgaac
aagacagatgtacttccatcagttactcagtacttaaagccaatgatggacaaatcgaaa
ttgtag

DBGET integrated database retrieval system