KEGG   Caenorhabditis briggsae: CBG09278Help
Entry
CBG09278          CDS       T01054                                 

Gene name
Cbr-pcm-1
Definition
(RefSeq) C. briggsae CBR-PCM-1 protein
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
cbr  Caenorhabditis briggsae
Brite
Enzymes [BR:cbr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     CBG09278 (Cbr-pcm-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCMT Methyltransf_31 MTS Methyltransf_32 Methyltransf_16 Methyltransf_25 PrmA Methyltransf_23 Ubie_methyltran Methyltransf_11 Methyltransf_3 RrnaAD DOT1 Methyltransf_4 GCD14
Motif
Other DBs
NCBI-GeneID: 8578825
NCBI-ProteinID: XP_002636830
WormBase: CBG09278
UniProt: A8X9G8
Position
V
AA seq 226 aa AA seqDB search
MAWRSSGSSNAELVENLRKNGVFSNQRAYDAMKAVDRGDFASRDPYEDAPQRIGYNATIS
APHMHAAALEYLQNHLVAGANALDVGSGSGYLTVCMAIMVGQTGTVVGIEHMSELVELST
KNIKKHHSEMIENGNVVMIDGDGRQGYAEKAPYNAIHVGAAAAGVPKALTDQLADGGRMM
IPVEQEDGNQVFMQIDKINGKIHEKIVEHVIYVPLTSRDKQWSHHH
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggcttggagatcgagtggctcgagcaatgcggagctcgttgaaaacttgagaaaaaat
ggagtgttcagcaatcaaagagcctacgatgcaatgaaggccgttgaccgtggtgacttc
gcatccagagatccctatgaagatgctccacagagaattggatacaatgccactatttca
gcgccacatatgcacgcagctgctctcgaatacctccagaaccacctggtcgctggtgca
aatgctctcgatgtcggttcgggaagtggatatttgacagtttgcatggcaataatggtt
ggacaaacaggaactgttgttggaatcgagcacatgtcggaattggtagaattgagcaca
aagaacatcaaaaaacatcacagtgagatgatagagaatggaaacgtcgttatgattgat
ggagacggtcgtcaagggtatgcagagaaggctccatacaatgcgattcacgttggagca
gctgcggcaggagtccccaaggcgctcactgaccaactggctgacggaggaagaatgatg
ataccagtggaacaagaagacggaaatcaggtcttcatgcaaatcgataaaatcaacggg
aagattcatgagaaaatcgtggagcatgtcatctacgtaccgttgacaagccgtgacaag
caatggagtcatcatcattaa

DBGET integrated database retrieval system