KEGG   Caenorhabditis briggsae: CBG09591Help
Entry
CBG09591          CDS       T01054                                 

Definition
(RefSeq) Hypothetical protein CBG09591
  KO
K12819  pre-mRNA-processing factor SLU7
Organism
cbr  Caenorhabditis briggsae
Pathway
cbr03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:cbr00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    CBG09591
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cbr03041]
    CBG09591
Spliceosome [BR:cbr03041]
 Complex C
  Other components
   Step II factors
    CBG09591
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Slu7 zf-CCHC zf-CCHC_4 zf-CCHC_6
Motif
Other DBs
NCBI-GeneID: 8579088
NCBI-ProteinID: XP_002637092
WormBase: CBG09591
UniProt: A8X8Q6
Position
V
AA seq 635 aa AA seqDB search
MASYKQNLPPSAVVRQHVSLADKKSKAEVQRDRQLEEDRKAGTAPAMVDVQTGRDINPHI
PMFISQNPWYVPSEGPTLKHQRPHEERQKNMTQIHEWYQKGTTGKSATKFRKGACENCGA
MGHQKRDCFDRPRKSNAKETNANIAEDDYVQPKLSLGFDAKRDRWNGYDPATHKQVIEDY
EHLEEARKVVKEHEMKEGESEVPTTEEGAPKDEDMYAEDADMAGVSVDMDSRTRITVRNL
RIREDTAKYLYNLAENSPYYDPKSRSMRENPFAGVAGKELEAARFSGDNFVRYSGEVTAA
NEAQVFAWQATRGGVYAHSIAEPTKLEALKKEYEKGKTTLKNETQKELLDKYGGGEHMER
PADELLLAQTESYIEYNRKGKVIKGKERAAISSRFKEDIYPQNHTSVFGSFWREGNWGYK
CCHQFVRNSYCTGKQGVDAESSAAKGTTTSNEQVFKAPKLVEPTEVKEEEMVKEESEEEE
ESVEPTKSPTPSDDEEKMKQYEEERRLEKERREREQRRRDKNREKRGRKKAKLGKRKRRH
RDSDEDSNSSGSSDSESDSDKERKETRRALKKANRERAEGMKAAKEGDRGRKYNTDYSNT
APTEKEMEAYRMTSVHSADPMAAYMNSKFEKKHCK
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcttacaagcagaaccttccgccgtcggcggtggttcgtcaacatgtgtccctc
gccgacaaaaaatctaaagccgaagttcaaagggatcgacaactagaagaagatcgtaaa
gctggaacggctccagctatggtagacgtacagactggacgcgacatcaatccacatatt
ccaatgttcatctctcaaaatccgtggtatgttcccagtgagggacctaccctgaagcat
caacgtccacatgaagaacggcagaaaaatatgactcaaattcatgaatggtatcagaaa
ggaacaacgggaaaatcagcgaccaagttccgtaaaggagcttgtgaaaactgtggtgca
atgggtcatcagaaaagagactgttttgataggccgagaaaatcgaatgctaaagaaaca
aacgccaacattgctgaagatgactatgttcaaccgaagttgtcccttggttttgatgca
aagagagacagatggaatggttatgatcctgccactcacaaacaagtaatcgaagattac
gaacatttggaagaagcgagaaaagttgtgaaagaacatgaaatgaaggaaggagaatca
gaagttccaacaactgaggaaggagctccaaaagacgaagatatgtacgcagaagacgct
gatatggctggagtatccgttgacatggattcccgtacgagaatcactgtcagaaacttg
agaattcgagaagacactgctaaatatctctataatcttgctgaaaattctccttactac
gatccaaaatctcgctctatgcgtgaaaatccttttgccggagtagctggaaaagaacta
gaagctgctcgtttctcaggtgacaactttgttcgctactctggcgaagtgacagcggct
aacgaagctcaagtttttgcctggcaagctacacgtggtggagtttatgctcattcgatt
gctgaaccaaccaaactggaagccttgaaaaaagaatacgagaaagggaaaacaaccttg
aaaaacgaaacacaaaaagaattgctggataaatatggaggtggagagcacatggagcgg
cctgctgacgaacttctcctcgcacaaaccgagtcttacatcgagtacaatcgaaaagga
aaagttatcaaaggaaaggagcgtgcagctatcagttctcggttcaaagaagatatttac
ccacagaaccatacatctgttttcggtagtttctggagagaaggaaactggggttacaag
tgctgtcatcaatttgtgagaaattcgtattgtactggaaagcaaggagtagatgccgag
tccagtgctgcaaagggtacaacaacatcgaatgaacaagtgttcaaagcgccaaaactt
gtggagccgacagaagtgaaggaggaagaaatggtgaaagaagaatctgaagaagaagaa
gagtccgtagaacccactaaatcgcctacgccttctgacgatgaagaaaaaatgaaacag
tacgaagaagaacgacgattggagaaggaacggagagaacgtgagcaaagaagacgcgac
aaaaaccgagagaagcgaggaagaaagaaggcaaaattgggaaaacgaaagaggcgtcat
cgtgattcagatgaagacagtaactcttccggtagcagcgattccgaatcggactccgat
aaagagagaaaagagacgcgcagagcattaaagaaagcaaatcgagaacgcgctgaagga
atgaaagcagccaaggagggtgatcgtgggaggaagtacaacacagactactcaaacact
gctcccaccgagaaggaaatggaagcttaccggatgacaagcgttcactcagctgatcct
atggctgcttatatgaattccaagtttgaaaagaaacactgcaagtag

DBGET integrated database retrieval system