KEGG   Caenorhabditis briggsae: CBG12465Help
Entry
CBG12465          CDS       T01054                                 

Definition
(RefSeq) Hypothetical protein CBG12465
  KO
K13179  ATP-dependent RNA helicase DDX18/HAS1 [EC:3.6.4.13]
Organism
cbr  Caenorhabditis briggsae
Brite
KEGG Orthology (KO) [BR:cbr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cbr03041]
    CBG12465
   03009 Ribosome biogenesis [BR:cbr03009]
    CBG12465
Enzymes [BR:cbr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     CBG12465
Spliceosome [BR:cbr03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    CBG12465
Ribosome biogenesis [BR:cbr03009]
 Eukaryotic type
  90S particles
   Helicases
    CBG12465
  Pre-60S particles
    CBG12465
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD Helicase_C DUF4217 ResIII SecA_DEAD DUF2075 CMS1
Motif
Other DBs
NCBI-GeneID: 8581730
NCBI-ProteinID: XP_002639737
WormBase: CBG12465
UniProt: A8XFI0
Position
I
AA seq 542 aa AA seqDB search
MGIDVKKKVLKRKLKQMKDGHEKKKAKEVVEEQPMEDDDGEKVEDEEQQAEENTGTKVSE
FLTKTTFASLDGKVNSNLLKSVQRLGFTTLTEIQAKTIDPLLEGKDVLASAKTGSGKTLA
FLLPAIELLHKLNWKQHNGTGVIIVSPTRELSMQTYGVLTELLEGSNLTFGLVMGGSNRS
AEKDKLAKGVSILVATPGRLLDHLQNDNFLVRNLKCLIIDEADRILDIGFEIEMQQVLRH
LPKQRQSMLFSATHSPKVDELVKLALHSNPVRVSVNEKAEEATVEGLQQGYIVAPSDKRL
LLLFTFLKKNKTKKVMVFFSSCNSVKFHHELLNYIDVPCMSIHGKQKQQKRTSTFFTFCQ
AESGILLCTDVAARGLDIPAVDWIVQYDPPDEPREYIHRVGRTARGTNGSGKALLVLRPE
ELGFLRYLKAAKVTLNEFEFSWNKVANIQTQLESLISKNYYLNKSAKEAYKCYLRAYDSH
SLKDIFDVTTMDLTAVSKSFGFSVPPFVDLPISNKPKVEIRSKLSGAGYRKKKQSFSFKT
KK
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgggcatcgatgtcaaaaagaaggtgctgaaacgaaaactgaaacaaatgaaggacggt
catgagaagaaaaaggccaaagaagtggtagaagagcaaccgatggaggacgatgatggt
gaaaaggtagaagatgaagaacaacaggctgaggagaatactggtaccaaggtttctgag
ttcttgacgaagacaactttcgcatcattggatggaaaagtaaactcaaatttgttgaag
tcggtgcaaagactgggcttcaccacattgactgaaattcaagccaaaacgatcgatccg
ttgcttgagggaaaagatgtgctagcctctgcgaagactggatcgggaaaaactctcgcg
tttctgcttcctgccattgaactccttcataaactgaactggaagcagcataatggaact
ggagtcatcatcgtctcgcctactcgcgagctttcgatgcaaacgtacggagtgttaacc
gagctcttggaaggttctaatttgacttttggactcgttatgggaggatcgaacagaagt
gcagaaaaagacaagctggctaaaggtgtttccatcttggtcgccactcctggacgtctt
ctcgaccatcttcaaaatgacaacttcctagttcgcaatttgaaatgtttgatcattgac
gaagctgatagaattctggatatcggattcgagattgagatgcaacaggttctccgtcat
ctgccaaaacaacgtcagtcgatgttgttctctgcaacacattctccaaaagttgacgaa
ttggtaaaattggctcttcattcaaatccagttcgtgtatcagtaaacgagaaagcagaa
gaagctactgtcgaaggattgcagcaaggatacattgtggctccttctgacaaacgtctt
ctccttttgttcacattcttgaagaaaaacaagactaagaaagtgatggtcttcttctcg
tcatgcaattcagtcaaattccatcatgagcttctcaactacattgacgttccgtgcatg
tctattcatggaaagcagaaacaacagaaacgtacttcaacattcttcacgttctgtcaa
gctgaaagtggaattctcctctgtaccgacgtcgctgctcgcggtctggacatcccagcg
gttgactggatcgttcagtacgatcctccagatgagccaagggaatacattcatcgcgtt
ggacgtacggcgcgtggaacaaatggaagtggaaaagcactgctcgttctgagaccggaa
gaacttggatttttgagatatttgaaagctgcgaaagttactttgaatgaattcgagttc
tcatggaacaaggtggccaacattcaaacacagctggagtctctcatcagtaaaaactat
tatctcaacaagtcggcaaaagaggcatacaagtgctatttgagagcgtatgattcccat
tcactgaaggacatcttcgatgtgactactatggacctaacagctgtttccaaatcattc
ggattctccgttcctccattcgtcgatcttccaatcagtaacaagccgaaggtggagatc
agatccaaactttccggggccggataccgcaagaagaagcagtcgttcagtttcaagacg
aagaaatga

DBGET integrated database retrieval system