KEGG   Caenorhabditis briggsae: CBG12484Help
Entry
CBG12484          CDS       T01054                                 

Definition
(RefSeq) Hypothetical protein CBG12484
  KO
K10739  replication factor A2
Organism
cbr  Caenorhabditis briggsae
Pathway
cbr03030  DNA replication
cbr03420  Nucleotide excision repair
cbr03430  Mismatch repair
cbr03440  Homologous recombination
cbr03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    CBG12484
   03420 Nucleotide excision repair
    CBG12484
   03430 Mismatch repair
    CBG12484
   03440 Homologous recombination
    CBG12484
   03460 Fanconi anemia pathway
    CBG12484
DNA replication proteins [BR:cbr03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    CBG12484
DNA repair and recombination proteins [BR:cbr03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     CBG12484
   MMR (mismatch exicision repair)
     CBG12484
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     CBG12484
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPA_C
Motif
Other DBs
NCBI-GeneID: 8582008
NCBI-ProteinID: XP_002640014
WormBase: CBG12484
Position
I
AA seq 265 aa AA seqDB search
MNGKRQSLQDQFEANMDFSSGDGWASHDVSQGRKIHSVGVIMEKVSEDGKTTYTLHDPEK
SEKTFYAIQFGQYDDGGSKFVAPGLIEDQRVRVMGKLKNVGGEKMILIYYLQQLGDDKDY
QIFKLEAEVAELFFKKNLLEKMRTGNTNGWTGMLAPPMTRYFDNFDANSFMHSEISKTPA
APIKIEQKLIQATPKTSSAFKAKIRACIRSEAERGTYGNDDGVPFTKIMSRMNGVSEQAL
REILTEMENSGMIYAAKHEEYMSLY
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaatggcaaacgacaaagtcttcaggatcaattcgaagcaaacatggatttcagcagc
ggtgacggatgggcctcgcacgatgtttcgcaagggagaaagattcattccgtcggtgta
atcatggagaaggtttcggaagacggaaaaaccacttatactcttcacgatccagagaaa
tccgagaagacgttctatgctattcagtttgggcaatatgatgacggaggatcaaagttt
gtggctcccggtttgatcgaggatcaaagggtacgagtgatgggaaagcttaaaaacgtc
ggtggcgagaaaatgattctcatatattacctccaacaattgggcgacgataaggactac
caaattttcaagcttgaagctgaagttgctgagttattcttcaaaaagaatttgcttgaa
aaaatgcggactggaaacaccaatgggtggactgggatgctggctccaccaatgaccaga
tacttcgataatttcgatgcaaattctttcatgcactcggaaatttcaaaaactccagct
gctcctatcaaaatagaacaaaaactcatccaagcaactcctaaaacatcatctgcgttc
aaagcgaagattcgagcttgcatcaggtcagaagctgaacgcggtacgtatggcaacgac
gatggtgtcccattcaccaaaattatgagcagaatgaatggcgtgtcagaacaagctctt
cgtgaaatcctcactgaaatggagaacagtggaatgatctacgccgctaagcacgaagaa
tatatgtctctgtattaa

DBGET integrated database retrieval system