KEGG   Caenorhabditis briggsae: CBG12962Help
Entry
CBG12962          CDS       T01054                                 

Definition
(RefSeq) Hypothetical protein CBG12962
  KO
K17550  protein phosphatase 1 regulatory subunit 7
Organism
cbr  Caenorhabditis briggsae
Brite
KEGG Orthology (KO) [BR:cbr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cbr01009]
    CBG12962
Protein phosphatases and associated proteins [BR:cbr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CBG12962
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_4 LRR_9 LRR_8
Motif
Other DBs
NCBI-GeneID: 8572040
NCBI-ProteinID: XP_002630524
WormBase: CBG12962
UniProt: A8XGS1
Position
II
AA seq 351 aa AA seqDB search
MNVTSVTSEDGVKEYEKIVVEPEEVEYVEIATDAKVVDLTRHRLKEIGDYSWLTHVEQFS
LRWNLLKKIENLDCLTTLTHLEFYDNQIEKVENLDALVNLEILDLSFNRILKIENLEKLT
KLKTLYFVHNKISKIEGLETLTELEYLELGDNRIAKIENLENNLKLDRLFLGANQIKIIE
NVDHLKNLTVLSLPANAITVVDNIAGLTNLKEIYLAQNGIKYVCGIDEHLPLEILDFNQN
RLEKVENIHQLTTLTDFWARGNQLSDWSILDELVRLPHLNCVYLDNNPFSQADTYRGKVL
RFLPQIDRLDGTQCREKSMLRPPKTEKQTTDLADVEFEKSSGGEQEPVEST
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtcaccagtgttacctctgaagacggtgttaaagaatacgaaaaaattgtcgtg
gaaccggaagaagtagaatatgttgagatcgctactgatgctaaagtagtcgacttgaca
cgtcatcgattgaaggaaatcggagactactcctggctcacccatgttgagcagttctct
cttcgttggaatttgctcaagaagattgagaatctggattgtttgacgacattgacccat
ctcgaattctatgacaatcaaattgagaaagtcgagaatttggatgctcttgtcaacttg
gaaattctggatttgtcgttcaatcgaatcttgaaaatcgagaatctcgagaagctgaca
aaactgaagacgctctattttgttcataacaagatctcaaaaatcgagggattggagacg
ttgacggagttggagtatctcgagttgggtgataatcgaatcgccaaaattgagaatttg
gagaataatctgaaattggatcgacttttccttggcgccaaccagattaaaatcattgaa
aatgtggatcatctgaagaatttaacagtgctcagtcttccagccaacgcgattactgta
gttgataatattgctggtctgaccaacttgaaagaaatctatctggctcaaaatggaatc
aagtatgtctgtggaatcgacgaacatcttccactagaaatccttgactttaatcaaaat
cgtctggaaaaagtggagaatattcatcagttgaccactcttactgacttctgggccaga
ggaaatcagctctccgattggagcattcttgatgaactcgttcgacttcctcacctcaat
tgcgtctatctggataacaatccgttctcccaggcggatacttatcgtggaaaagttctc
cgcttccttccccaaattgatcgtctggatggaactcaatgtcgtgagaagtctatgctc
cgccctccgaaaactgagaagcaaaccactgatttggctgatgtcgaattcgagaaatcc
agtggtggagaacaagagccagtcgaatcaacttga

DBGET integrated database retrieval system