KEGG   Caenorhabditis briggsae: CBG13232Help
Entry
CBG13232          CDS       T01054                                 

Definition
(RefSeq) Hypothetical protein CBG13232
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
cbr  Caenorhabditis briggsae
Pathway
cbr03040  Spliceosome
cbr04010  MAPK signaling pathway
cbr04141  Protein processing in endoplasmic reticulum
cbr04144  Endocytosis
cbr04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:cbr00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    CBG13232
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CBG13232
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    CBG13232
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    CBG13232
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    CBG13232
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cbr01009]
    CBG13232
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cbr03041]
    CBG13232
   03009 Ribosome biogenesis [BR:cbr03009]
    CBG13232
   03110 Chaperones and folding catalysts [BR:cbr03110]
    CBG13232
   04131 Membrane trafficking [BR:cbr04131]
    CBG13232
   03051 Proteasome [BR:cbr03051]
    CBG13232
   03029 Mitochondrial biogenesis [BR:cbr03029]
    CBG13232
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cbr04147]
    CBG13232
Protein phosphatases and associated proteins [BR:cbr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     CBG13232
Spliceosome [BR:cbr03041]
 Complex B
  Other components
   Prp19 complex
    CBG13232
 Complex C
   Prp19-CDC5 complex
    CBG13232
Ribosome biogenesis [BR:cbr03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    CBG13232
Chaperones and folding catalysts [BR:cbr03110]
 Heat shock proteins
  HSP70 / DNAK
   CBG13232
Membrane trafficking [BR:cbr04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    CBG13232
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    CBG13232
Proteasome [BR:cbr03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    CBG13232
Mitochondrial biogenesis [BR:cbr03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    CBG13232
Exosome [BR:cbr04147]
 Exosomal proteins
  Proteins found in most exosomes
   CBG13232
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl Hydantoinase_A StbA Arfaptin FtsA
Motif
Other DBs
NCBI-GeneID: 8583367
NCBI-ProteinID: XP_002641375
WormBase: CBG13232
Position
III
AA seq 276 aa AA seqDB search
MSSCKAIGIDLGTTYSCVGVYQNGKVEILANSEGNKTTPSYVAFTDTERLVGDAAKDQAA
RNPENTVFDAKRLIGRRFDEETVQSDCKHWPFGVKGKQGKPVIEVEMKGEKRQFNPEEIS
AMVLQKMKETAETYLGHAVKDTVITVPAYFNDSQRQATKDAATIAGLNAIRIINEPTAAA
LAYGLDKGISEEMNVLIFDLGGGTFDVSILSIAEGSIFEVKSTAGDTHLGGEDFDXXXXV
DSKTVTLFLKCIICSSRSFYSNEITDLKLKKEHGIQ
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcgtgcaaagctattggaatcgacctcggtacgacatattcatgtgttggagtc
taccagaatggaaaggttgaaattcttgccaactcagaaggaaacaaaacaacgccttca
tatgttgcattcactgatacagaacgattggttggagatgcggcaaaagatcaagcagct
cgtaatccagagaatacagtattcgatgcaaaacgattgattggacgacgttttgatgaa
gaaacagttcaatcagactgcaaacattggccatttggcgtaaaaggaaaacaaggaaaa
ccagtgatcgaagtggaaatgaaaggagaaaagagacagttcaatccagaagaaatctca
gcaatggtacttcagaaaatgaaggaaactgcagagacatacctgggacatgcagtcaag
gatacagtgattactgtacctgcatacttcaacgacagtcagagacaagcaaccaaagat
gcagctaccattgctggactcaatgccatccgaatcatcaatgaaccgactgcagctgct
cttgcttatggattggataaaggaatcagtgaagagatgaatgtactgatctttgatctt
ggaggaggtacttttgatgtttcaatcctttcaattgctgaaggatcaatattcgaagtc
aagtccacagctggagatactcatcttggaggagaggatttcgatcnnnnnnnnnncgtt
gatagcaaaactgtgacactatttttgaaatgtattatttgcagttctagaagcttctac
tcgaatgagattacggatttaaaattaaaaaaagagcacggtatccaataa

DBGET integrated database retrieval system