KEGG   Caenorhabditis briggsae: CBG13352Help
Entry
CBG13352          CDS       T01054                                 

Gene name
Cbr-hda-2
Definition
(RefSeq) C. briggsae CBR-HDA-2 protein
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
cbr  Caenorhabditis briggsae
Pathway
cbr04213  Longevity regulating pathway - multiple species
cbr04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    CBG13352 (Cbr-hda-2)
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    CBG13352 (Cbr-hda-2)
Enzymes [BR:cbr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     CBG13352 (Cbr-hda-2)
Chromosome and associated proteins [BR:cbr03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     CBG13352 (Cbr-hda-2)
   HDAC complexes
    Sin3A-HDAC complex
     CBG13352 (Cbr-hda-2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    CBG13352 (Cbr-hda-2)
  Chromatin remodeling factors
   NuRD complex
    CBG13352 (Cbr-hda-2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 8572952
NCBI-ProteinID: XP_002629990
WormBase: CBG13352
UniProt: A8XHZ1
Position
II
AA seq 503 aa AA seqDB search
MACERPISLYDSDDEDIVYDGDDVRKRNVAYYYHPDVGHFHYGQLHPMKPQRLVVCNDLV
ASYEMPRYMTVVQSPKLEASDIAAFHSQDYVNFLQTVTPKLATTMQDDVLRKFNIGEDCP
LFAGLWDYCTLYSGGSVEGARRLNHKMNDIVINWPGGLHHAKKSEASGFCYVNDIVLGIL
ELLKYHKRVLYIDIDIHHGDGVQEAFNNSDRVMTVSFHRFGQYFPGSGSIMDKGVGPGKY
FAINLPLMAAIRDEPYVKLFESVISSVEENFNPEAIVLQCGSDSLCEDRLGQFALSFNAH
ARAVKYVKSLGKPLMVLGGGGYTLRNVARCWALETGVILGLRMKDEIPESSLYSHYFSPR
LLRPLLTPKMADANSPAYLDSIEKETLECLRMIRGAPSVQMQEIVGIRLDEIEQIEENER
LARTSMEKEVYKMTEKMEEDCFVEDRHHPTSSASYPQGEDPRRIGQYWGYDGLAPPRSRS
DVIEEEKYEDKERRKNLNMPGIP
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggcctgcgagagaccaatctcgctgtacgacagcgacgacgaggacattgtatacgat
ggggatgatgtgcggaagcgtaacgtcgcctattactatcatccagacgtcggacatttc
cactatggtcaacttcatccgatgaaaccgcaacggctagtggtatgcaacgatctggtc
gcctcatacgaaatgcctcgatacatgacagtcgttcaatcgccgaaactcgaagcatcc
gacatcgccgcgtttcactcccaagactatgtcaatttccttcaaaccgtcactccgaaa
ctcgcgacgacgatgcaagacgacgtgcttcgaaagttcaacatcggcgaggattgcccg
ttattcgctggcctttgggactactgtacactgtattcgggtggatcagtggagggtgca
agacggttgaatcataagatgaacgacatcgttatcaattggcctggcggacttcatcat
gcgaagaaatcagaagcatccggattctgttacgttaatgatattgtgttgggaattcta
gagctactgaagtaccataaaagagtactgtacattgacattgacatacatcatggagat
ggtgtccaggaagcgtttaacaattcggatcgagttatgacagtatcattccatagattc
ggtcagtatttcccaggatccggaagtattatggataaaggagtgggtcctggaaagtac
tttgctattaatctcccattaatggctgcgattcgagatgagccttatgtgaagttgttt
gaaagtgttataagtagtgtcgaggagaatttcaacccggaagcgattgtactgcagtgt
ggatcagattcgctgtgtgaggatcgtctcggacagtttgctctatcattcaacgcgcac
gctcgcgccgtaaaatatgtaaaaagtctcggaaaaccgctgatggttctcggcggcggt
ggctacactctccgcaacgtggctcgttgctgggcactggaaaccggagtgattcttggc
cttcgaatgaaagacgagatcccagagtcctctctctactcccactacttctcgccacga
ctacttcgtccgttgttgacgccgaagatggctgacgccaactcgcctgcctatctggat
tccatcgaaaaagagacgctggaatgcttgcgaatgattcgtggcgctccgtcggttcag
atgcaagagatcgttggcattcgactggatgaaatcgagcaaatcgaggagaacgagcgg
ctcgcgaggacttccatggagaaggaggtgtacaaaatgacggagaaaatggaggaggac
tgtttcgtagaagaccgacaccatccgacgtcttctgcttcctatccacaaggagaagat
ccacgacgaatcggccaatattgggggtacgacgggttggcaccgcccagaagtcgttca
gatgtaattgaagaggagaagtacgaggataaagagcgacggaagaacctgaacatgccg
ggaattccttaa

DBGET integrated database retrieval system