KEGG   Caenorhabditis briggsae: CBG16194Help
Entry
CBG16194          CDS       T01054                                 

Definition
(RefSeq) Hypothetical protein CBG16194
  KO
K06210  nicotinamide mononucleotide adenylyltransferase [EC:2.7.7.1 2.7.7.18]
Organism
cbr  Caenorhabditis briggsae
Pathway
cbr00760  Nicotinate and nicotinamide metabolism
cbr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    CBG16194
Enzymes [BR:cbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     CBG16194
    2.7.7.18  nicotinate-nucleotide adenylyltransferase
     CBG16194
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTP_transf_like
Motif
Other DBs
NCBI-GeneID: 8585511
NCBI-ProteinID: XP_002643518
WormBase: CBG16194
UniProt: A8XNX0
Position
X
AA seq 216 aa AA seqDB search
MEKSKVVILAVGSFNPPTFGHLRMLEDAKNSLELSGKEVVEGILSPVSDAYGKSTLIGSN
HRLAMTEAAVKSSDWLRADGWECSQPVWTTTLNVLKHHQQEVKIRLGPDVEVLLIVGGDV
VETFDKYNADGSLVWNLEDVQEIVSIGLVVQPRPGSDPEETLKNLDFLGWTQNVNVIASN
VISSTSLRAAIKEHRSIKYTTPDEVITYIKEHNLYE
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagtcaaaagtggtaatccttgctgtcgggtctttcaatccgccaactttcggt
catttgcgcatgttggaggatgccaaaaactcgttggaattatctggaaaagaagtggtg
gagggaattttgagtccagtcagtgatgcgtatggaaaatcgacgttgattggatctaat
cacagacttgccatgactgaagcagcagtgaagagttctgattggttgcgcgctgacggt
tgggaatgctcccagcccgtgtggaccactactctgaacgtgctcaaacatcatcagcaa
gaagtcaagatccgccttggacccgacgttgaggtacttcttattgttggcggtgacgtg
gtggaaacgttcgacaagtacaacgctgatggatcgttggtttggaatctggaggatgtt
caggagattgtgtcgattggattggttgtgcagccaagaccagggtcggatccggaagag
acattgaagaatttggatttcttgggatggactcaaaacgttaacgtcattgcttccaat
gtcatcagttccaccagcctccgtgccgctatcaaagagcaccgctctatcaaatacacc
actccggatgaagtcattacctacattaaggagcacaacctctatgagtaa

DBGET integrated database retrieval system